BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30078X (420 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_33554| Best HMM Match : Sushi (HMM E-Value=0.00055) 38 0.004 SB_52009| Best HMM Match : Plasmodium_HRP (HMM E-Value=7.9) 38 0.004 SB_8814| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.39 SB_57086| Best HMM Match : PT (HMM E-Value=2.4) 31 0.39 SB_8332| Best HMM Match : PDZ (HMM E-Value=1.3e-17) 29 1.2 SB_29906| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.6 SB_56517| Best HMM Match : CUB (HMM E-Value=0.0011) 28 2.7 SB_35971| Best HMM Match : RRM_1 (HMM E-Value=0.013) 28 2.7 SB_34661| Best HMM Match : Fz (HMM E-Value=0.00016) 28 2.7 SB_20760| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.7 SB_57005| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.6 SB_7770| Best HMM Match : Aldolase_II (HMM E-Value=2.6e-12) 27 4.8 SB_56900| Best HMM Match : I-set (HMM E-Value=8e-10) 27 6.3 SB_51293| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.3 SB_39564| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.3 SB_23051| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.3 SB_5515| Best HMM Match : PspA_IM30 (HMM E-Value=0.14) 27 6.3 SB_53613| Best HMM Match : Sugar_tr (HMM E-Value=0.00012) 27 8.3 SB_34943| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_58963| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_37633| Best HMM Match : DUF327 (HMM E-Value=2.1) 27 8.3 >SB_33554| Best HMM Match : Sushi (HMM E-Value=0.00055) Length = 685 Score = 37.5 bits (83), Expect = 0.004 Identities = 24/72 (33%), Positives = 31/72 (43%), Gaps = 3/72 (4%) Frame = -3 Query: 283 ASTRIDTRAWLMRWIPPSPSWLVSKLSHSTYRPHTYTNRTCTHTYAAPLPHTHKHMYIN- 107 A+TR T+A + P V H+ R T R CT+T+ H H H Y N Sbjct: 244 ANTRTRTKARKCTYTQPGTQMHVHAPGHANARTRTQA-RKCTYTHPGTQMHVHAHKYANA 302 Query: 106 --YTTTRIHVYT 77 +T TR YT Sbjct: 303 HTHTQTRKCTYT 314 Score = 30.7 bits (66), Expect = 0.51 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = -3 Query: 184 HTYTNRTCTHTYAAPLPHTHKHMYINYTTTRIHVYT 77 H T H YA THK+MY + T++HV+T Sbjct: 494 HANTRGAPRHAYARTRTQTHKYMY-THPDTQMHVHT 528 Score = 27.5 bits (58), Expect = 4.8 Identities = 19/64 (29%), Positives = 27/64 (42%) Frame = -3 Query: 283 ASTRIDTRAWLMRWIPPSPSWLVSKLSHSTYRPHTYTNRTCTHTYAAPLPHTHKHMYINY 104 A+ R T+A + P V ++ HT T R CT+T+ H H + N Sbjct: 272 ANARTRTQARKCTYTHPGTQMHVHAHKYANAHTHTQT-RKCTYTHPGMQMHVHAPRHAN- 329 Query: 103 TTTR 92 T TR Sbjct: 330 TCTR 333 >SB_52009| Best HMM Match : Plasmodium_HRP (HMM E-Value=7.9) Length = 231 Score = 37.5 bits (83), Expect = 0.004 Identities = 24/72 (33%), Positives = 31/72 (43%), Gaps = 3/72 (4%) Frame = -3 Query: 283 ASTRIDTRAWLMRWIPPSPSWLVSKLSHSTYRPHTYTNRTCTHTYAAPLPHTHKHMYIN- 107 A+TR T+A + P V H+ R T R CT+T+ H H H Y N Sbjct: 19 ANTRTRTKARKCTYTQPGTQMHVHAPGHANARTRTQA-RKCTYTHPGTQMHVHAHKYANA 77 Query: 106 --YTTTRIHVYT 77 +T TR YT Sbjct: 78 HTHTQTRKCTYT 89 Score = 27.5 bits (58), Expect = 4.8 Identities = 19/64 (29%), Positives = 27/64 (42%) Frame = -3 Query: 283 ASTRIDTRAWLMRWIPPSPSWLVSKLSHSTYRPHTYTNRTCTHTYAAPLPHTHKHMYINY 104 A+ R T+A + P V ++ HT T R CT+T+ H H + N Sbjct: 47 ANARTRTQARKCTYTHPGTQMHVHAHKYANAHTHTQT-RKCTYTHPGMQMHVHAPRHAN- 104 Query: 103 TTTR 92 T TR Sbjct: 105 TCTR 108 >SB_8814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 824 Score = 31.1 bits (67), Expect = 0.39 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = -3 Query: 211 KLSHSTYRPHTYTNRTCTHTYAAPLPHTHKHMYINYTTTR 92 K + Y HT+T+ THT+ P TH H + TTR Sbjct: 391 KYDTTRYSTHTHTHLHDTHTHETPRHDTHLHDTHPHETTR 430 >SB_57086| Best HMM Match : PT (HMM E-Value=2.4) Length = 226 Score = 31.1 bits (67), Expect = 0.39 Identities = 15/38 (39%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = -3 Query: 187 PHTYTNRTCTHTYAAPLPHTHKHMYIN-YTTTRIHVYT 77 PH Y ++ TH Y PH + H Y + YT H YT Sbjct: 31 PHQYPHQY-THQYTHQYPHQYTHQYTHQYTHQYTHQYT 67 Score = 30.3 bits (65), Expect = 0.68 Identities = 14/37 (37%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = -3 Query: 184 HTYTNRTCTHTYAAPLPHTHKHMYIN-YTTTRIHVYT 77 H YT+ TH Y PH + H Y + Y H YT Sbjct: 88 HQYTHHQYTHQYTHQYPHQYPHQYPHQYPHQYPHQYT 124 Score = 29.5 bits (63), Expect = 1.2 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = -3 Query: 187 PHTYTNRTCTHTYAAPLPHTHKHMY 113 PH YT++ CTH Y H + H Y Sbjct: 196 PHQYTHQ-CTHQYTHQYTHQYTHQY 219 Score = 29.1 bits (62), Expect = 1.6 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = -3 Query: 184 HTYTNRTCTHTYAAPLPHTHKHMYINYTTTRIHVYT 77 H YT++ TH Y P H + H Y ++ T H YT Sbjct: 68 HQYTHQY-THPYTHPYTHQYTHQYTHHQYT--HQYT 100 Score = 28.3 bits (60), Expect = 2.7 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 2/44 (4%) Frame = -3 Query: 202 HSTYR-PHTYTNRTCTHTYAAPLPHTHKHMYIN-YTTTRIHVYT 77 H T++ H Y ++ TH Y PH + H Y + YT H YT Sbjct: 9 HYTHQYTHQYPHQY-THQYTHQYPHQYPHQYTHQYTHQYPHQYT 51 Score = 27.5 bits (58), Expect = 4.8 Identities = 15/40 (37%), Positives = 19/40 (47%), Gaps = 4/40 (10%) Frame = -3 Query: 184 HTYTNRTC---THTYAAPLPHTHKHMYIN-YTTTRIHVYT 77 H YT++ TH Y P H + H Y + YT H YT Sbjct: 161 HQYTHQCTHPYTHQYTHPYTHPYTHPYTHQYTHQYPHQYT 200 Score = 26.6 bits (56), Expect = 8.3 Identities = 16/47 (34%), Positives = 21/47 (44%), Gaps = 4/47 (8%) Frame = -3 Query: 205 SHSTYRPHTYTNR---TCTHTYAAPLPHTHKHMYIN-YTTTRIHVYT 77 +H Y H YT++ H Y PH + H Y + YT H YT Sbjct: 91 THHQYT-HQYTHQYPHQYPHQYPHQYPHQYPHQYTHQYTHQYTHQYT 136 >SB_8332| Best HMM Match : PDZ (HMM E-Value=1.3e-17) Length = 1038 Score = 29.5 bits (63), Expect = 1.2 Identities = 17/58 (29%), Positives = 28/58 (48%), Gaps = 2/58 (3%) Frame = -3 Query: 193 YRPHTYTNRTCTHTYA--APLPHTHKHMYINYTTTRIHVYT*CNNIY*YFM*IYLRFS 26 YRP+ + RT H Y A + T+ H+Y Y HVY ++Y + +Y ++ Sbjct: 730 YRPYAHVYRTYAHVYRTYARVYRTYAHVYRTYA----HVYRPYAHVYRTYARVYRTYA 783 >SB_29906| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2463 Score = 29.1 bits (62), Expect = 1.6 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = -3 Query: 196 TYRPHTYTNRTC-THTYAAPLPHTHKHMYINYTT 98 TY H NRTC TH TH+ M YTT Sbjct: 1368 TYTTHAQMNRTCTTHAQMNRTCTTHEQMNRTYTT 1401 Score = 28.3 bits (60), Expect = 2.7 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = -3 Query: 196 TYRPHTYTNRTC-THTYAAPLPHTHKHMYINYTT 98 TY H NRTC TH TH+ M YTT Sbjct: 1338 TYTTHEQMNRTCTTHAKMNRTCTTHEQMNRTYTT 1371 Score = 27.9 bits (59), Expect = 3.6 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = -3 Query: 196 TYRPHTYTNRTC-THTYAAPLPHTHKHMYINYTT 98 TY H NRTC TH TH+ M YTT Sbjct: 1428 TYTTHVQMNRTCTTHEQMNRTCTTHEQMNRAYTT 1461 Score = 27.1 bits (57), Expect = 6.3 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = -3 Query: 196 TYRPHTYTNRTC-THTYAAPLPHTHKHMYINYTT 98 TY H NRTC TH TH M YTT Sbjct: 1308 TYITHAQMNRTCTTHAQMNRTYITHAQMNRTYTT 1341 Score = 26.6 bits (56), Expect = 8.3 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = -3 Query: 196 TYRPHTYTNRTC-THTYAAPLPHTHKHMYINYTT 98 TY H NRTC TH TH M YTT Sbjct: 1518 TYTIHAQMNRTCTTHAQMNRTCITHAQMDRTYTT 1551 >SB_56517| Best HMM Match : CUB (HMM E-Value=0.0011) Length = 734 Score = 28.3 bits (60), Expect = 2.7 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 10/53 (18%) Frame = -3 Query: 205 SHSTYRPHTYTNRTCTHTYAAP--------LPHTHKHMY--INYTTTRIHVYT 77 +HS ++T RT HT++ P + HTH H + +++T T IH ++ Sbjct: 348 THSHSHALSFTPRTVIHTHSHPHALSFTRTIIHTHSHSHHALSFTCTLIHTHS 400 Score = 28.3 bits (60), Expect = 2.7 Identities = 11/37 (29%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Frame = -3 Query: 184 HTYTNRTCTHTYAAPLPHTHKH-MYINYTTTRIHVYT 77 HT+++ ++ L HTH H + +++T+T IH ++ Sbjct: 380 HTHSHSHHALSFTCTLIHTHSHSLALSFTSTLIHTHS 416 >SB_35971| Best HMM Match : RRM_1 (HMM E-Value=0.013) Length = 665 Score = 28.3 bits (60), Expect = 2.7 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 2/50 (4%) Frame = -3 Query: 256 WLMRWIPPSPSWLVS--KLSHSTYRPHTYTNRTCTHTYAAPLPHTHKHMY 113 W+++ + PSP L ++ H+ YR H YT ++ +PH H H+Y Sbjct: 227 WVIQPLVPSPLALAPPWRIIHN-YRHHLYTTVIIYTPPSSSIPHRH-HLY 274 Score = 27.5 bits (58), Expect = 4.8 Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 3/48 (6%) Frame = -3 Query: 193 YRPHTYTNRTCTHTYAAPLPHTHKHMY---INYTTTRIHVYT*CNNIY 59 +R H YT ++P+PH H H+Y I YT ++ C+++Y Sbjct: 269 HRHHLYTTAIIYTPLSSPIPHRH-HLYTTVIIYTPPSSSIHH-CHHLY 314 >SB_34661| Best HMM Match : Fz (HMM E-Value=0.00016) Length = 486 Score = 28.3 bits (60), Expect = 2.7 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = -3 Query: 205 SHSTYRPHTYTNRTCTHTYAAPLPHTHKHMYINYTTTR 92 ++ T HTY R +HTY HT++ +Y++ TR Sbjct: 294 TYRTRYSHTYRTRY-SHTYRTRYSHTYRTIYLHTYRTR 330 >SB_20760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 230 Score = 28.3 bits (60), Expect = 2.7 Identities = 14/40 (35%), Positives = 17/40 (42%), Gaps = 5/40 (12%) Frame = -3 Query: 190 RPHTYTNRTCTHTYAAP-----LPHTHKHMYINYTTTRIH 86 R T T T H Y P T +H Y Y TT++H Sbjct: 99 RQETITPETSRHNYTPKRHDTITPQTSRHNYTRYVTTQLH 138 >SB_57005| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 251 Score = 27.9 bits (59), Expect = 3.6 Identities = 18/46 (39%), Positives = 23/46 (50%), Gaps = 3/46 (6%) Frame = -3 Query: 208 LSHSTYRPHTYTNRTCTHTYAA-PLPHTHKHMYINYTT--TRIHVY 80 L H+ H+ T CT T+A L HTH MY N T T+ H + Sbjct: 119 LKHTHTTMHSNTRTLCTQTHARYALKHTHT-MYSNTHTLCTQTHAH 163 >SB_7770| Best HMM Match : Aldolase_II (HMM E-Value=2.6e-12) Length = 716 Score = 27.5 bits (58), Expect = 4.8 Identities = 19/40 (47%), Positives = 23/40 (57%) Frame = -3 Query: 286 SASTRIDTRAWLMRWIPPSPSWLVSKLSHSTYRPHTYTNR 167 S +T TRA L + P S VS+ SHST R +TY NR Sbjct: 115 SPATTTSTRAQLF-FTPDSDQKGVSR-SHSTGRANTYRNR 152 >SB_56900| Best HMM Match : I-set (HMM E-Value=8e-10) Length = 968 Score = 27.1 bits (57), Expect = 6.3 Identities = 15/53 (28%), Positives = 22/53 (41%) Frame = -3 Query: 235 PSPSWLVSKLSHSTYRPHTYTNRTCTHTYAAPLPHTHKHMYINYTTTRIHVYT 77 PSP+ V H+ YT+ TH Y P + ++ + IH YT Sbjct: 373 PSPTHRVHTRLHTNLHAQ-YTHAEYTHAYTPSTPKATRLVHPHLHAKYIHAYT 424 Score = 26.6 bits (56), Expect = 8.3 Identities = 23/82 (28%), Positives = 35/82 (42%), Gaps = 8/82 (9%) Frame = -3 Query: 307 STGSKTRSASTRIDTRAWLMRWIPPSPSWLVSKLSHS--------TYRPHTYTNRTCTHT 152 ST S T TR+ T+ + + P P L ++ +H+ T+R H + THT Sbjct: 818 STPSPTHRVHTRLHTK-YTHAYTPIHPR-LHAEYTHAYTPSTPKPTHRVHPSLHAGYTHT 875 Query: 151 YAAPLPHTHKHMYINYTTTRIH 86 Y P Y + T R+H Sbjct: 876 YTPSTPTPTHAEYTHAYTRRVH 897 >SB_51293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 305 Score = 27.1 bits (57), Expect = 6.3 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = -3 Query: 253 LMRWIPPSPSWLVSK 209 L +WIP +P WL++K Sbjct: 92 LWKWIPETPPWLIAK 106 >SB_39564| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 279 Score = 27.1 bits (57), Expect = 6.3 Identities = 13/42 (30%), Positives = 20/42 (47%) Frame = -3 Query: 202 HSTYRPHTYTNRTCTHTYAAPLPHTHKHMYINYTTTRIHVYT 77 HST+ +TYT + T H H+ + TT +H +T Sbjct: 105 HSTHTLNTYTQQHAHSTRKLHTYTQHAHLTRHSTTRALHTHT 146 >SB_23051| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2141 Score = 27.1 bits (57), Expect = 6.3 Identities = 15/48 (31%), Positives = 23/48 (47%) Frame = -3 Query: 226 SWLVSKLSHSTYRPHTYTNRTCTHTYAAPLPHTHKHMYINYTTTRIHV 83 +W L+ T+ T+ T TH + + THKH+ I T T H+ Sbjct: 416 AWTHKHLTIVTWTHKHLTSGTWTHKHLTIVTRTHKHLTI-VTRTHKHL 462 >SB_5515| Best HMM Match : PspA_IM30 (HMM E-Value=0.14) Length = 388 Score = 27.1 bits (57), Expect = 6.3 Identities = 15/55 (27%), Positives = 24/55 (43%) Frame = -2 Query: 404 FKDQLKTLTG*LXXXXXXXXXXXXXXXRLQKEVDRLEDEIGINKDRYKSLADEMD 240 +K Q +TL LQ E+D L +E+ +R +SL DE++ Sbjct: 123 YKQQTETLESLFAAVNHNNENLINENLLLQAELDNLNNELKAKDNRIESLQDELE 177 >SB_53613| Best HMM Match : Sugar_tr (HMM E-Value=0.00012) Length = 466 Score = 26.6 bits (56), Expect = 8.3 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = -3 Query: 247 RWIPPSPSWLVS 212 RWIP SP WLV+ Sbjct: 242 RWIPESPRWLVA 253 >SB_34943| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 26.6 bits (56), Expect = 8.3 Identities = 19/66 (28%), Positives = 28/66 (42%), Gaps = 3/66 (4%) Frame = -3 Query: 265 TRAWLMRWIPPSPSWLVSKLSHSTYRPHTYTNRTCTHTYAAPLPHTHKHMYINYTTTR-- 92 T+A+ R P + + K +H+ Y YT+ TH Y + H H + T T Sbjct: 52 TQAYTRRVRPLLHTPVTPKPTHAEYTHAEYTHAEYTHAYTRRV-HPRLHTPVTPTPTHAE 110 Query: 91 -IHVYT 77 H YT Sbjct: 111 YTHAYT 116 >SB_58963| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 218 Score = 26.6 bits (56), Expect = 8.3 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -3 Query: 187 PHTYTNRTCTHTYAAPLPHT 128 PH + T HTY AP+ HT Sbjct: 38 PHLHCPYTSHHTYIAPIHHT 57 >SB_37633| Best HMM Match : DUF327 (HMM E-Value=2.1) Length = 355 Score = 26.6 bits (56), Expect = 8.3 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = -2 Query: 320 LQKEVDRLEDEIGINKDRYKSLADEMDS 237 + K V R DE+ K R SLAD+ DS Sbjct: 47 ISKHVTRQLDEVQATKARRSSLADDWDS 74 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,592,020 Number of Sequences: 59808 Number of extensions: 180518 Number of successful extensions: 722 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 539 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 703 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 789494848 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -