BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30072 (587 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC222.10c |byr4||two-component GAP Byr4|Schizosaccharomyces po... 27 2.7 SPAC13A11.04c |ubp8||ubiquitin C-terminal hydrolase Ubp8|Schizos... 26 4.7 SPAC12B10.13 |||CTLH domain|Schizosaccharomyces pombe|chr 1|||Ma... 25 8.2 SPBC577.11 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||... 25 8.2 >SPAC222.10c |byr4||two-component GAP Byr4|Schizosaccharomyces pombe|chr 1|||Manual Length = 665 Score = 26.6 bits (56), Expect = 2.7 Identities = 12/24 (50%), Positives = 15/24 (62%), Gaps = 2/24 (8%) Frame = -2 Query: 445 HLGST--WRPKISKRSTTKHKNGL 380 H GST W + RST+KH+N L Sbjct: 417 HAGSTQEWHSHTTPRSTSKHENNL 440 >SPAC13A11.04c |ubp8||ubiquitin C-terminal hydrolase Ubp8|Schizosaccharomyces pombe|chr 1|||Manual Length = 449 Score = 25.8 bits (54), Expect = 4.7 Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 4/45 (8%) Frame = +2 Query: 251 SLKCIYFCLAYKKKRIAYLVFYSFSLIIN----S*CIKSYVFNEK 373 SLK + CL KK+R+A SL IN C++ +V EK Sbjct: 268 SLKNVVTCLDCKKERVAVDPLMDISLDINEPTLQGCLERFVSKEK 312 >SPAC12B10.13 |||CTLH domain|Schizosaccharomyces pombe|chr 1|||Manual Length = 240 Score = 25.0 bits (52), Expect = 8.2 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +2 Query: 176 TYSTVINNINKYQQRYKIAFRKNIRSLK 259 +YS + N+ Y QR ++A N+ LK Sbjct: 172 SYSPALKNVLNYSQRERVANLANVSILK 199 >SPBC577.11 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 239 Score = 25.0 bits (52), Expect = 8.2 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 2/31 (6%) Frame = -2 Query: 466 LTASAPSHLGSTWRPKISK--RSTTKHKNGL 380 L AP++ G TW ++SK RS K GL Sbjct: 59 LYEKAPAYTGHTWYGRVSKHTRSLKTFKKGL 89 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,096,389 Number of Sequences: 5004 Number of extensions: 41278 Number of successful extensions: 153 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 147 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 153 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 254167452 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -