BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30071 (685 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB023025-1|BAA74592.1| 133|Apis mellifera actin protein. 258 5e-71 DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monoo... 25 0.67 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 22 6.3 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 22 6.3 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 21 8.3 >AB023025-1|BAA74592.1| 133|Apis mellifera actin protein. Length = 133 Score = 258 bits (631), Expect = 5e-71 Identities = 120/121 (99%), Positives = 121/121 (100%) Frame = -1 Query: 685 KSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANT 506 KSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANT Sbjct: 13 KSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANT 72 Query: 505 VLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWI 326 VLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPE+KYSVWIGGSILASLSTFQQMWI Sbjct: 73 VLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPEKKYSVWIGGSILASLSTFQQMWI 132 Query: 325 S 323 S Sbjct: 133 S 133 >DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monooxygenase protein. Length = 499 Score = 25.0 bits (52), Expect = 0.67 Identities = 21/62 (33%), Positives = 30/62 (48%) Frame = -1 Query: 559 NSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSV 380 N +K D DI++ Y + V MYP + M+K I+ + KI I P E K + Sbjct: 342 NKELKYD-DIKEMEYLDKVFKETLRMYPPASILMRKAISDYTFNDTKITI--PKEMK--I 396 Query: 379 WI 374 WI Sbjct: 397 WI 398 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 21.8 bits (44), Expect = 6.3 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = -3 Query: 506 RIVRWYHHVPWNRRPYAK 453 RI+ +YH +++PY K Sbjct: 424 RIIDYYHSYKMHQKPYNK 441 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 21.8 bits (44), Expect = 6.3 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = -3 Query: 506 RIVRWYHHVPWNRRPYAK 453 RI+ +YH +++PY K Sbjct: 424 RIIDYYHSYKMHQKPYNK 441 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 21.4 bits (43), Expect = 8.3 Identities = 10/37 (27%), Positives = 19/37 (51%) Frame = -1 Query: 610 QPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVL 500 + +FLG+ + +YN + D + KDL+ +L Sbjct: 328 ETTFLGLIRLIVLNLSYNMLTHIDARMFKDLFFLQIL 364 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 195,410 Number of Sequences: 438 Number of extensions: 4355 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20830365 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -