BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30067 (475 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor pro... 23 1.3 EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 23 2.2 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 22 2.9 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 22 2.9 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 22 2.9 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 22 2.9 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 22 2.9 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 22 2.9 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 22 2.9 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 22 2.9 AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 22 3.8 AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein... 21 5.1 AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein... 21 5.1 DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly pro... 21 8.9 >DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor protein. Length = 405 Score = 23.4 bits (48), Expect = 1.3 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +3 Query: 243 TDEAEVCICSRWQGPRHQYCQSWILQVARQRQTPQT 350 +DEAE S+ G + QS I +VAR+ +T T Sbjct: 272 SDEAEPSSTSKKSGIVRSHQQSCINRVARETKTAGT 307 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 22.6 bits (46), Expect = 2.2 Identities = 8/27 (29%), Positives = 15/27 (55%) Frame = +3 Query: 288 RHQYCQSWILQVARQRQTPQTTCHSKS 368 RH ++W+ R + TPQ+ S++ Sbjct: 241 RHLERKAWVASFGRPKMTPQSLLPSQT 267 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 2.9 Identities = 9/32 (28%), Positives = 20/32 (62%) Frame = +3 Query: 243 TDEAEVCICSRWQGPRHQYCQSWILQVARQRQ 338 ++++E + SR Q R + + W++Q R+R+ Sbjct: 20 SEDSETGLRSRTQEERLRRRREWMIQQERERE 51 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 2.9 Identities = 9/32 (28%), Positives = 20/32 (62%) Frame = +3 Query: 243 TDEAEVCICSRWQGPRHQYCQSWILQVARQRQ 338 ++++E + SR Q R + + W++Q R+R+ Sbjct: 20 SEDSETGLRSRTQEERLRRRREWMIQQERERE 51 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 2.9 Identities = 9/32 (28%), Positives = 20/32 (62%) Frame = +3 Query: 243 TDEAEVCICSRWQGPRHQYCQSWILQVARQRQ 338 ++++E + SR Q R + + W++Q R+R+ Sbjct: 20 SEDSETGLRSRTQEERLRRRREWMIQQERERE 51 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 2.9 Identities = 9/32 (28%), Positives = 20/32 (62%) Frame = +3 Query: 243 TDEAEVCICSRWQGPRHQYCQSWILQVARQRQ 338 ++++E + SR Q R + + W++Q R+R+ Sbjct: 20 SEDSETGLRSRTQEERLRRRREWMIQQERERE 51 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 2.9 Identities = 9/32 (28%), Positives = 20/32 (62%) Frame = +3 Query: 243 TDEAEVCICSRWQGPRHQYCQSWILQVARQRQ 338 ++++E + SR Q R + + W++Q R+R+ Sbjct: 20 SEDSETGLRSRTQEERLRRRREWMIQQERERE 51 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 2.9 Identities = 9/32 (28%), Positives = 20/32 (62%) Frame = +3 Query: 243 TDEAEVCICSRWQGPRHQYCQSWILQVARQRQ 338 ++++E + SR Q R + + W++Q R+R+ Sbjct: 20 SEDSETGLRSRTQEERLRRRREWMIQQERERE 51 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 22.2 bits (45), Expect = 2.9 Identities = 9/32 (28%), Positives = 20/32 (62%) Frame = +3 Query: 243 TDEAEVCICSRWQGPRHQYCQSWILQVARQRQ 338 ++++E + SR Q R + + W++Q R+R+ Sbjct: 20 SEDSETGLRSRTQEERLRRRREWMIQQERERE 51 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 22.2 bits (45), Expect = 2.9 Identities = 9/32 (28%), Positives = 20/32 (62%) Frame = +3 Query: 243 TDEAEVCICSRWQGPRHQYCQSWILQVARQRQ 338 ++++E + SR Q R + + W++Q R+R+ Sbjct: 20 SEDSETGLRSRTQEERLRRRREWMIQQERERE 51 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 21.8 bits (44), Expect = 3.8 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 235 VSEQTRLKYASAPDGKVPVI 294 V EQT A D KVP+I Sbjct: 230 VKEQTLQSIEMAKDAKVPII 249 >AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 21.4 bits (43), Expect = 5.1 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +3 Query: 228 DISL*TDEAEVCICSRWQGPRHQYCQ 305 D+S E + CI + Q R QYC+ Sbjct: 141 DLSYACREEKSCIIDKRQRNRCQYCR 166 >AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 21.4 bits (43), Expect = 5.1 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +3 Query: 228 DISL*TDEAEVCICSRWQGPRHQYCQ 305 D+S E + CI + Q R QYC+ Sbjct: 141 DLSYACREEKSCIIDKRQRNRCQYCR 166 >DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly protein 9 protein. Length = 423 Score = 20.6 bits (41), Expect = 8.9 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = -3 Query: 260 YFSLVCSETNVQSLSKFK 207 YFS+VC SL FK Sbjct: 11 YFSIVCQAKAHYSLRDFK 28 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 114,111 Number of Sequences: 438 Number of extensions: 2472 Number of successful extensions: 14 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 12805416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -