BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30063 (825 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-4|CAD27926.1| 338|Anopheles gambiae putative hox prote... 26 1.2 AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containi... 26 1.6 AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/p... 25 2.1 DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doub... 25 2.8 AY146725-1|AAO12085.1| 155|Anopheles gambiae odorant-binding pr... 24 4.9 AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. 23 8.6 >AJ439353-4|CAD27926.1| 338|Anopheles gambiae putative hox protein protein. Length = 338 Score = 26.2 bits (55), Expect = 1.2 Identities = 14/67 (20%), Positives = 32/67 (47%) Frame = +2 Query: 92 FRRLSSVSSTPGTPTLY*TPQAIRTV*HGTSISGSARGPARTKPARRPSSR*TWTTNNSR 271 +R+L TP Y + + ++ G++++ +A G + + P PS+ + T + Sbjct: 125 YRKLYRGEKTPERYAPYLAVRPVESLTSGSNVAAAAAGASASTPPTIPSASPSPTRSTDL 184 Query: 272 DQRYSTE 292 Q Y+ + Sbjct: 185 SQTYAID 191 >AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containing protein I protein. Length = 1340 Score = 25.8 bits (54), Expect = 1.6 Identities = 19/57 (33%), Positives = 30/57 (52%) Frame = -1 Query: 741 KLLIVAPFFGISDGLLVAGAEGIEEPVEDSIVRFGVNHFDIGPSIVILVFNLVGYGD 571 ++L V F G + GLLV G + I E ++V +++F+ S V L+ L G D Sbjct: 8 RILTVIIFIGAAHGLLVVGPKFIRANQEYTLV---ISNFNSQLSKVDLLLKLEGETD 61 >AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/proton exchanger 3 protein. Length = 1221 Score = 25.4 bits (53), Expect = 2.1 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = +1 Query: 250 LDDEQFQGSAVQHREVQYYESKEFLEYFSPAIRYLKG 360 +D+ G+ Q+ + +KE+L Y SP+ +L G Sbjct: 957 VDESDDNGAIKQNEFPSWASNKEYLAYNSPSATFLGG 993 >DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doublesex protein protein. Length = 622 Score = 25.0 bits (52), Expect = 2.8 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +2 Query: 257 TNNSRDQRYSTERSNITSPRSS*NISHQPSAI*KADTPQA 376 T + D+ S R+N T S ++S S +A+TP+A Sbjct: 259 TEDDEDENISVTRTNSTIRSRSSSLSRSRSCSRQAETPRA 298 >AY146725-1|AAO12085.1| 155|Anopheles gambiae odorant-binding protein AgamOBP6 protein. Length = 155 Score = 24.2 bits (50), Expect = 4.9 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +1 Query: 727 DDQEFECVVTKEVSLSEISDK 789 DDQEF+C V + L++ S K Sbjct: 74 DDQEFKCYVACLMDLTQTSKK 94 >AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. Length = 1376 Score = 23.4 bits (48), Expect = 8.6 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = -1 Query: 150 GVQYNVGVPGVEETELSLRNGDRFEV 73 G N +PGVEE L N + EV Sbjct: 1296 GFGNNDNLPGVEEVAAELENANESEV 1321 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.317 0.136 0.397 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 839,470 Number of Sequences: 2352 Number of extensions: 17340 Number of successful extensions: 31 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 87734433 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -