BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30061 (739 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neu... 24 1.5 AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. 23 1.9 >AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neuroblasts defectiveprotein protein. Length = 224 Score = 23.8 bits (49), Expect = 1.5 Identities = 15/60 (25%), Positives = 28/60 (46%) Frame = +3 Query: 462 SELAYLTPWTAPTPYPSPDLTQ*PLRSTSPYQSTGPYRYPYLMQYPYPWSNKLEYQSPLR 641 +E ++P T PTP P P+ P + S + + L++ +++ + Y S LR Sbjct: 88 AEKVSVSPTTPPTPSPPPEERLTPSKDASSKRIXTAFTSTQLLELEREFASNM-YLSRLR 146 >AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. Length = 456 Score = 23.4 bits (48), Expect = 1.9 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = -1 Query: 718 DDGFHIRYSHWSGYWYGN 665 D FH +Y+H+ +YG+ Sbjct: 437 DPAFHNQYAHYPAEYYGH 454 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 119,266 Number of Sequences: 336 Number of extensions: 2217 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19779950 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -