BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30061 (739 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ974171-1|ABJ52811.1| 403|Anopheles gambiae serpin 14 protein. 29 0.11 AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein hom... 23 7.4 >DQ974171-1|ABJ52811.1| 403|Anopheles gambiae serpin 14 protein. Length = 403 Score = 29.5 bits (63), Expect = 0.11 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -1 Query: 556 WYGDVLLNGYWVRSGDGYGVGAVHGVRYANS 464 WYG V+L WV + G GVG + +R+ S Sbjct: 2 WYGTVVLFLLWVLAESGSGVGGLTQLRFPYS 32 >AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein homolog protein. Length = 394 Score = 23.4 bits (48), Expect = 7.4 Identities = 16/47 (34%), Positives = 20/47 (42%), Gaps = 5/47 (10%) Frame = +3 Query: 507 PSPDLTQ*PLRSTSPYQSTGPYR-----YPYLMQYPYPWSNKLEYQS 632 PSP +T +SP TG P ++ PY W K YQS Sbjct: 159 PSPPITVSGSDMSSPGAPTGSSSPQITPRPTPVKSPYEWMKKQSYQS 205 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 533,829 Number of Sequences: 2352 Number of extensions: 8767 Number of successful extensions: 29 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 75676146 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -