BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30057 (631 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_UPI0000ECD483 Cluster: UPI0000ECD483 related cluster; n... 68 2e-10 UniRef50_Q7RED5 Cluster: Putative uncharacterized protein PY0513... 44 0.003 UniRef50_A7SUZ6 Cluster: Predicted protein; n=2; Eukaryota|Rep: ... 38 0.20 UniRef50_A2GSA9 Cluster: Putative uncharacterized protein; n=3; ... 37 0.46 UniRef50_Q7N0G3 Cluster: Similarities with ribonuclease; n=1; Ph... 35 1.9 UniRef50_A4S1P1 Cluster: Predicted protein; n=1; Ostreococcus lu... 33 4.3 UniRef50_A1VP16 Cluster: Peptidase C14, caspase catalytic subuni... 33 7.5 UniRef50_UPI0000F1F069 Cluster: PREDICTED: hypothetical protein;... 32 9.9 >UniRef50_UPI0000ECD483 Cluster: UPI0000ECD483 related cluster; n=1; Gallus gallus|Rep: UPI0000ECD483 UniRef100 entry - Gallus gallus Length = 103 Score = 67.7 bits (158), Expect = 2e-10 Identities = 38/72 (52%), Positives = 42/72 (58%) Frame = +3 Query: 414 GAPTARRTNATTSFLTATILVYXXXXXXXXXXXXRLALQLVLGKIFKVYLFRLPGLVRVP 593 G P AR + TTSFLTA L+Y RLALQ +L K FKV F+L GL RV Sbjct: 30 GGPPARSQDPTTSFLTAATLIYAIGAGITAAAGTRLALQWILVKGFKVDSFQLQGLERVL 89 Query: 594 YRYFSSLPSRAG 629 Y YFSSLP R G Sbjct: 90 YCYFSSLPPRVG 101 >UniRef50_Q7RED5 Cluster: Putative uncharacterized protein PY05130; n=6; Plasmodium (Vinckeia)|Rep: Putative uncharacterized protein PY05130 - Plasmodium yoelii yoelii Length = 402 Score = 44.0 bits (99), Expect = 0.003 Identities = 18/26 (69%), Positives = 22/26 (84%) Frame = +3 Query: 72 GKCFR*CSSCDDPRISPLTSQYECPQ 149 GKCFR C S ++ RISPLTS+Y+CPQ Sbjct: 259 GKCFRSCLSPENLRISPLTSEYKCPQ 284 >UniRef50_A7SUZ6 Cluster: Predicted protein; n=2; Eukaryota|Rep: Predicted protein - Nematostella vectensis Length = 79 Score = 37.9 bits (84), Expect = 0.20 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = -2 Query: 63 FHQSRTKVRGSKAIRYRPSSN 1 F RTKVRGSK IRYRPSSN Sbjct: 6 FRCQRTKVRGSKTIRYRPSSN 26 >UniRef50_A2GSA9 Cluster: Putative uncharacterized protein; n=3; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 76 Score = 36.7 bits (81), Expect = 0.46 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = +2 Query: 488 SWNYRGCWHQTCPSIG 535 SWNYR CWHQT P +G Sbjct: 7 SWNYRSCWHQTGPLLG 22 >UniRef50_Q7N0G3 Cluster: Similarities with ribonuclease; n=1; Photorhabdus luminescens subsp. laumondii|Rep: Similarities with ribonuclease - Photorhabdus luminescens subsp. laumondii Length = 272 Score = 34.7 bits (76), Expect = 1.9 Identities = 18/55 (32%), Positives = 24/55 (43%), Gaps = 1/55 (1%) Frame = +2 Query: 368 SPTICSANVSVSPRMRCTDSAAH-KCNYELFNRNNFSIRYWSWNYRGCWHQTCPS 529 SP C R++ ++ A + YE F FS +SW G W QTC S Sbjct: 92 SPAFCKGKAKNIERLKKSNKLAEAQREYEKFELQCFSENKFSWVIHGLWAQTCDS 146 >UniRef50_A4S1P1 Cluster: Predicted protein; n=1; Ostreococcus lucimarinus CCE9901|Rep: Predicted protein - Ostreococcus lucimarinus CCE9901 Length = 72 Score = 33.5 bits (73), Expect = 4.3 Identities = 15/21 (71%), Positives = 15/21 (71%) Frame = -2 Query: 63 FHQSRTKVRGSKAIRYRPSSN 1 FH RTKV GSK IRY PS N Sbjct: 6 FHCQRTKVGGSKMIRYHPSLN 26 >UniRef50_A1VP16 Cluster: Peptidase C14, caspase catalytic subunit p20; n=1; Polaromonas naphthalenivorans CJ2|Rep: Peptidase C14, caspase catalytic subunit p20 - Polaromonas naphthalenivorans (strain CJ2) Length = 562 Score = 32.7 bits (71), Expect = 7.5 Identities = 14/33 (42%), Positives = 21/33 (63%) Frame = +2 Query: 392 VSVSPRMRCTDSAAHKCNYELFNRNNFSIRYWS 490 V+ PR+R D AA + NY L NR+N+ + W+ Sbjct: 163 VNAPPRVRAADPAAVQANY-LANRSNYEVSQWT 194 >UniRef50_UPI0000F1F069 Cluster: PREDICTED: hypothetical protein; n=1; Danio rerio|Rep: PREDICTED: hypothetical protein - Danio rerio Length = 389 Score = 32.3 bits (70), Expect = 9.9 Identities = 15/31 (48%), Positives = 21/31 (67%) Frame = +2 Query: 83 SLMFVLRRSKNFTSNVAIRMPPVIPINHYLG 175 S+M V+ RS FT IR+PP+ I+H+LG Sbjct: 20 SVMGVVERSAVFTRQRDIRLPPIPGISHHLG 50 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 592,504,715 Number of Sequences: 1657284 Number of extensions: 11028034 Number of successful extensions: 23956 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 23372 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23950 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 46466611856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -