BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30057 (631 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g10890.1 68417.m01772 expressed protein 27 7.8 At3g49060.1 68416.m05360 protein kinase family protein / U-box d... 27 7.8 >At4g10890.1 68417.m01772 expressed protein Length = 527 Score = 27.5 bits (58), Expect = 7.8 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = -2 Query: 102 RKTNISESICQRCFHQS-RTKVRGSKAIRYRPSSN 1 ++T I +C RC+H S R K+R S R S++ Sbjct: 194 KQTKICSRVCSRCYHYSMRQKLRHSLHTRILKSNS 228 >At3g49060.1 68416.m05360 protein kinase family protein / U-box domain-containing protein contains Pfam profile: PF00069 Eukaryotic protein kinase domain Length = 805 Score = 27.5 bits (58), Expect = 7.8 Identities = 12/45 (26%), Positives = 22/45 (48%) Frame = +2 Query: 65 HLWQMLSLMFVLRRSKNFTSNVAIRMPPVIPINHYLGVLKTNKIE 199 H+W + + R+ N SN MPP++ ++ K+ K+E Sbjct: 162 HIWFLCKGYLIFTRASNDDSNNRQTMPPLVQLDSDNETRKSEKLE 206 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,673,541 Number of Sequences: 28952 Number of extensions: 240582 Number of successful extensions: 494 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 488 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 494 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1285411824 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -