BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30052X (386 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z35604-6|CAA84681.1| 305|Caenorhabditis elegans Hypothetical pr... 28 2.6 Z81560-2|CAB04547.1| 1021|Caenorhabditis elegans Hypothetical pr... 27 3.5 Z82057-5|CAB04861.3| 325|Caenorhabditis elegans Hypothetical pr... 27 6.1 Z81540-5|CAB04405.2| 946|Caenorhabditis elegans Hypothetical pr... 27 6.1 Z81142-11|CAB03512.3| 325|Caenorhabditis elegans Hypothetical p... 27 6.1 >Z35604-6|CAA84681.1| 305|Caenorhabditis elegans Hypothetical protein ZK1058.6 protein. Length = 305 Score = 27.9 bits (59), Expect = 2.6 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +3 Query: 108 GEESRLTASLAERGEILAVVDLRRRHVVTLY 200 GEES+L SLA + I V+ + R TLY Sbjct: 81 GEESKLIESLAAQNNIHIVIGVVEREASTLY 111 >Z81560-2|CAB04547.1| 1021|Caenorhabditis elegans Hypothetical protein K02E2.2 protein. Length = 1021 Score = 27.5 bits (58), Expect = 3.5 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +2 Query: 122 THCESS*ERGNPCCRRPSAAS 184 THCE GN CC P A++ Sbjct: 253 THCEKERRDGNKCCSGPLAST 273 >Z82057-5|CAB04861.3| 325|Caenorhabditis elegans Hypothetical protein ZK1037.11 protein. Length = 325 Score = 26.6 bits (56), Expect = 6.1 Identities = 16/41 (39%), Positives = 23/41 (56%) Frame = +1 Query: 13 QCNTIHTLVNILYIYFKNNSTYIIICNSSFEREKNLDSLRV 135 Q N I L++IL I F YII+ + +REKNL + + Sbjct: 29 QNNFIRVLLSILIIIFP---LYIIVYRKNRKREKNLPTFPI 66 >Z81540-5|CAB04405.2| 946|Caenorhabditis elegans Hypothetical protein F46B3.5 protein. Length = 946 Score = 26.6 bits (56), Expect = 6.1 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +2 Query: 122 THCESS*ERGNPCCRRPSAAS 184 THCES GN CC AA+ Sbjct: 269 THCESGKRDGNKCCDARLAAT 289 >Z81142-11|CAB03512.3| 325|Caenorhabditis elegans Hypothetical protein ZK1037.11 protein. Length = 325 Score = 26.6 bits (56), Expect = 6.1 Identities = 16/41 (39%), Positives = 23/41 (56%) Frame = +1 Query: 13 QCNTIHTLVNILYIYFKNNSTYIIICNSSFEREKNLDSLRV 135 Q N I L++IL I F YII+ + +REKNL + + Sbjct: 29 QNNFIRVLLSILIIIFP---LYIIVYRKNRKREKNLPTFPI 66 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,773,382 Number of Sequences: 27780 Number of extensions: 87925 Number of successful extensions: 206 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 205 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 206 length of database: 12,740,198 effective HSP length: 74 effective length of database: 10,684,478 effective search space used: 576961812 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -