BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30051 (688 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB023025-1|BAA74592.1| 133|Apis mellifera actin protein. 246 2e-67 DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monoo... 25 0.68 DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 24 1.6 AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein ... 23 2.1 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 23 2.1 L10430-1|AAA27731.1| 150|Apis mellifera transposase protein. 22 4.8 AY155490-1|AAO12861.1| 342|Apis mellifera Ammar1 transposase pr... 22 6.3 >AB023025-1|BAA74592.1| 133|Apis mellifera actin protein. Length = 133 Score = 246 bits (602), Expect = 2e-67 Identities = 113/119 (94%), Positives = 117/119 (98%) Frame = -2 Query: 687 YELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETVYNSIMKCDVDIRKDLYANPVM 508 YELPDGQVITIGNERFRCPEALFQPSFLGME+CGIHET YNSIMKCDVDIRKDLYAN V+ Sbjct: 15 YELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVL 74 Query: 507 SGGTTMYPGIADRMQKEITALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQMWIS 331 SGGTTMYPGIADRMQKEITALAPST+KIKIIAPPE+KYSVWIGGSILASLSTFQQMWIS Sbjct: 75 SGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPEKKYSVWIGGSILASLSTFQQMWIS 133 >DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monooxygenase protein. Length = 499 Score = 25.0 bits (52), Expect = 0.68 Identities = 21/62 (33%), Positives = 30/62 (48%) Frame = -2 Query: 567 NSIMKCDVDIRKDLYANPVMSGGTTMYPGIADRMQKEITALAPSTIKIKIIAPPERKYSV 388 N +K D DI++ Y + V MYP + M+K I+ + KI I P E K + Sbjct: 342 NKELKYD-DIKEMEYLDKVFKETLRMYPPASILMRKAISDYTFNDTKITI--PKEMK--I 396 Query: 387 WI 382 WI Sbjct: 397 WI 398 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 23.8 bits (49), Expect = 1.6 Identities = 17/59 (28%), Positives = 27/59 (45%), Gaps = 2/59 (3%) Frame = +1 Query: 157 DGVRLDVQFSGITRYNVLTVAFRTRTSTTPHSTGVT--RPRCLEALAVDDAGAGLVVFL 327 D +LD F T+ N + ++ R++ STT G T + + AL +D FL Sbjct: 354 DSAKLDKIFDIATKENAMLLSGRSQKSTTGPPPGPTPAQKARMRALNIDRVSRVFFPFL 412 >AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein protein. Length = 352 Score = 23.4 bits (48), Expect = 2.1 Identities = 13/60 (21%), Positives = 26/60 (43%), Gaps = 3/60 (5%) Frame = -1 Query: 568 QLHHEVRRRHP*GPVRQPRH---VRWYHHVPRYRRQDAEGDHRPRALDHQDQDHRSPREE 398 Q+HH++ +HP +Q +H + H + + + +A Q Q PR++ Sbjct: 167 QMHHQMHTQHPHMQPQQGQHQSQAQQQHLQAHEQHMMYQQQQQSQAASQQSQPGMHPRQQ 226 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 23.4 bits (48), Expect = 2.1 Identities = 11/47 (23%), Positives = 22/47 (46%) Frame = -1 Query: 526 VRQPRHVRWYHHVPRYRRQDAEGDHRPRALDHQDQDHRSPREEVLRM 386 +++ H++ +HH + + HRP Q Q + R+E R+ Sbjct: 138 LQRHHHLQNHHH--HLQSTAVQDHHRPYQQQQQQQQRQQQRQEERRL 182 Score = 23.0 bits (47), Expect = 2.7 Identities = 9/45 (20%), Positives = 20/45 (44%) Frame = -1 Query: 532 GPVRQPRHVRWYHHVPRYRRQDAEGDHRPRALDHQDQDHRSPREE 398 G QP H + +HH + + A+ + + Q Q + +++ Sbjct: 804 GDQSQPPHQQLHHHQSTHPQAQAQAQPQQQQQQQQQQPQQQQQQQ 848 >L10430-1|AAA27731.1| 150|Apis mellifera transposase protein. Length = 150 Score = 22.2 bits (45), Expect = 4.8 Identities = 10/32 (31%), Positives = 15/32 (46%), Gaps = 2/32 (6%) Frame = +2 Query: 536 RMSTSHFMMELYT--VSWMPHDSIPRKEGWKR 625 R F+ L T W+ +++I RK W R Sbjct: 18 RSENDPFLKRLITGDEKWVVYNNIKRKRSWSR 49 >AY155490-1|AAO12861.1| 342|Apis mellifera Ammar1 transposase protein. Length = 342 Score = 21.8 bits (44), Expect = 6.3 Identities = 10/32 (31%), Positives = 15/32 (46%), Gaps = 2/32 (6%) Frame = +2 Query: 536 RMSTSHFMMELYT--VSWMPHDSIPRKEGWKR 625 R F+ L T W+ +++I RK W R Sbjct: 139 RNENDPFLKRLITGDEKWVVYNNIKRKRSWSR 170 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 170,132 Number of Sequences: 438 Number of extensions: 3573 Number of successful extensions: 18 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20952180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -