BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30045 (660 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292366-1|CAL23178.2| 379|Tribolium castaneum gustatory recept... 24 1.3 AM292329-1|CAL23141.2| 379|Tribolium castaneum gustatory recept... 24 1.3 AY920544-1|AAX62142.1| 463|Tribolium castaneum cytochrome P450 ... 23 2.9 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 21 6.8 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 21 6.8 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 21 6.8 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 21 6.8 U81040-1|AAB39356.1| 283|Tribolium castaneum TC Deformed protein. 21 9.0 U81038-1|AAB39355.1| 412|Tribolium castaneum transcription fact... 21 9.0 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 21 9.0 AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. 21 9.0 >AM292366-1|CAL23178.2| 379|Tribolium castaneum gustatory receptor candidate 45 protein. Length = 379 Score = 23.8 bits (49), Expect = 1.3 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = -1 Query: 645 LFCLVSRVSLHFLTSHLKRRSKI 577 LFC++ V LHFLT +L K+ Sbjct: 173 LFCVLYVVLLHFLTYNLSLGIKL 195 >AM292329-1|CAL23141.2| 379|Tribolium castaneum gustatory receptor candidate 8 protein. Length = 379 Score = 23.8 bits (49), Expect = 1.3 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = -1 Query: 645 LFCLVSRVSLHFLTSHLKRRSKI 577 LFC++ V LHFLT +L K+ Sbjct: 173 LFCVLYVVLLHFLTYNLSLGIKL 195 >AY920544-1|AAX62142.1| 463|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 463 Score = 22.6 bits (46), Expect = 2.9 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +2 Query: 200 NDVMDYNIVSQGKTVIP 250 N + ++IV GKTVIP Sbjct: 423 NCIAKFDIVPNGKTVIP 439 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.4 bits (43), Expect = 6.8 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = -3 Query: 121 SLLGDDTSLLKQIGFDVSTSQFSGWT 44 ++LG T L +G V+ Q WT Sbjct: 920 TILGPGTIFLMLVGAFVAAFQIDNWT 945 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.4 bits (43), Expect = 6.8 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = -3 Query: 121 SLLGDDTSLLKQIGFDVSTSQFSGWT 44 ++LG T L +G V+ Q WT Sbjct: 920 TILGPGTIFLMLVGAFVAAFQIDNWT 945 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.4 bits (43), Expect = 6.8 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = -3 Query: 121 SLLGDDTSLLKQIGFDVSTSQFSGWT 44 ++LG T L +G V+ Q WT Sbjct: 920 TILGPGTIFLMLVGAFVAAFQIDNWT 945 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.4 bits (43), Expect = 6.8 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = -3 Query: 121 SLLGDDTSLLKQIGFDVSTSQFSGWT 44 ++LG T L +G V+ Q WT Sbjct: 920 TILGPGTIFLMLVGAFVAAFQIDNWT 945 >U81040-1|AAB39356.1| 283|Tribolium castaneum TC Deformed protein. Length = 283 Score = 21.0 bits (42), Expect = 9.0 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = +3 Query: 306 VSPKRRKTMYTR 341 + PKR++T YTR Sbjct: 231 MEPKRQRTAYTR 242 >U81038-1|AAB39355.1| 412|Tribolium castaneum transcription factor Deformed protein. Length = 412 Score = 21.0 bits (42), Expect = 9.0 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = +3 Query: 306 VSPKRRKTMYTR 341 + PKR++T YTR Sbjct: 231 MEPKRQRTAYTR 242 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 21.0 bits (42), Expect = 9.0 Identities = 9/36 (25%), Positives = 20/36 (55%) Frame = -1 Query: 648 CLFCLVSRVSLHFLTSHLKRRSKIPLQRAPTELMTW 541 C++C S SL +TSH+++ + ++++W Sbjct: 481 CMWCGQSFRSLAEMTSHMQQTQHYTNIISQEQIISW 516 >AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. Length = 412 Score = 21.0 bits (42), Expect = 9.0 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = +3 Query: 306 VSPKRRKTMYTR 341 + PKR++T YTR Sbjct: 231 MEPKRQRTAYTR 242 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 141,892 Number of Sequences: 336 Number of extensions: 2858 Number of successful extensions: 11 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17073220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -