BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30041X (402 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_01_0047 - 323097-323162,323287-323900,324233-324626,324718-32... 86 1e-17 01_07_0285 - 42476767-42476832,42476990-42477603,42477821-424782... 86 1e-17 12_01_0409 - 3230853-3230918,3231372-3231994,3232454-3232847,323... 85 3e-17 01_06_1455 + 37504175-37504231,37504357-37504750,37504865-375054... 85 3e-17 05_04_0450 - 21356877-21356942,21357482-21358095,21358173-213585... 84 3e-17 03_06_0585 - 34912159-34912224,34912634-34913247,34913350-349137... 84 3e-17 03_05_0926 + 28871800-28871859,28871943-28872336,28872586-288731... 83 6e-17 10_08_0597 + 19089616-19089675,19089789-19090182,19090451-190910... 83 8e-17 11_01_0403 + 3059650-3059709,3059807-3060200,3060275-3060930,306... 69 1e-12 03_06_0192 + 32230953-32231030,32231130-32231485,32232250-322324... 53 1e-07 08_01_0254 + 2078380-2078392,2078487-2078578,2079579-2079698,207... 47 5e-06 12_02_1282 + 27528159-27529148,27529549-27529614 46 1e-05 02_04_0473 + 23197294-23197340,23197443-23197680,23197792-231980... 38 0.002 08_01_0194 - 1603702-1603782,1603970-1604062,1604203-1604328,160... 35 0.021 01_01_1170 - 9318332-9318461,9318551-9318613,9318694-9318744,931... 34 0.037 04_04_1515 + 34117383-34117732,34117833-34117918,34118227-341182... 29 1.8 01_01_0292 - 2387653-2387711,2388061-2388684,2388814-2389104,238... 28 3.2 01_06_1783 + 39845998-39846174,39846260-39846534,39846758-398468... 27 5.6 08_02_0829 - 21604845-21605588 27 7.3 04_04_1136 - 31142742-31142806,31143245-31143325,31143432-311435... 27 7.3 09_03_0151 - 12794082-12795110 26 9.7 05_03_0002 - 7278527-7279675,7279768-7280325,7280433-7280594 26 9.7 01_07_0053 + 40772966-40773080,40773484-40773578,40773730-407738... 26 9.7 >05_01_0047 - 323097-323162,323287-323900,324233-324626,324718-324777 Length = 377 Score = 85.8 bits (203), Expect = 1e-17 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 KYSVWIGGSILASLSTFQQMWISK+EY+ESGP IVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWISKDEYDESGPAIVHRKCF 377 >01_07_0285 - 42476767-42476832,42476990-42477603,42477821-42478214, 42478301-42478360 Length = 377 Score = 85.8 bits (203), Expect = 1e-17 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 KYSVWIGGSILASLSTFQQMWISK+EY+ESGP IVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWISKDEYDESGPAIVHRKCF 377 >12_01_0409 - 3230853-3230918,3231372-3231994,3232454-3232847, 3233000-3233059 Length = 380 Score = 84.6 bits (200), Expect = 3e-17 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 KYSVWIGGSILASLSTFQQMWISK EY+ESGP IVHRKCF Sbjct: 341 KYSVWIGGSILASLSTFQQMWISKAEYDESGPAIVHRKCF 380 >01_06_1455 + 37504175-37504231,37504357-37504750,37504865-37505478, 37506021-37506086 Length = 376 Score = 84.6 bits (200), Expect = 3e-17 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 KYSVWIGGSILASLSTFQQMWISK EY+ESGPGIVH KCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKAEYDESGPGIVHMKCF 376 >05_04_0450 - 21356877-21356942,21357482-21358095,21358173-21358566, 21358648-21358704 Length = 376 Score = 84.2 bits (199), Expect = 3e-17 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 KYSVWIGGSILASLSTFQQMWISK EY+ESGPGIVH KCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKGEYDESGPGIVHMKCF 376 >03_06_0585 - 34912159-34912224,34912634-34913247,34913350-34913734, 34913824-34913883 Length = 374 Score = 84.2 bits (199), Expect = 3e-17 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 KYSVWIGGSILASLSTFQQMWISK EY+ESGP IVHRKCF Sbjct: 335 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 374 >03_05_0926 + 28871800-28871859,28871943-28872336,28872586-28873199, 28873281-28873346 Length = 377 Score = 83.4 bits (197), Expect = 6e-17 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 KYSVWIGGSILASLSTFQQMWI+K EY+ESGP IVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 377 >10_08_0597 + 19089616-19089675,19089789-19090182,19090451-19091064, 19091160-19091225 Length = 377 Score = 83.0 bits (196), Expect = 8e-17 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 KYSVWIGGSILASLSTFQQMWIS+ EY ESGP IVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWISRAEYEESGPAIVHRKCF 377 >11_01_0403 + 3059650-3059709,3059807-3060200,3060275-3060930, 3060979-3061044 Length = 391 Score = 69.3 bits (162), Expect = 1e-12 Identities = 37/54 (68%), Positives = 38/54 (70%), Gaps = 14/54 (25%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQ--------------MWISKEEYNESGPGIVHRKCF 283 KYSVWIGGSILASLSTFQQ MWISK EY+ESGP IVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQVNLTPTLYEVARMQMWISKGEYDESGPAIVHRKCF 391 >03_06_0192 + 32230953-32231030,32231130-32231485,32232250-32232425, 32233857-32234038,32234260-32234443,32235192-32235259, 32235343-32235495 Length = 398 Score = 52.8 bits (121), Expect = 1e-07 Identities = 20/40 (50%), Positives = 30/40 (75%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 +YS W+GG+ILA + Q ++K +Y+E+GP IVH+KCF Sbjct: 359 RYSAWLGGAILAKVVFPQNQHVTKGDYDETGPSIVHKKCF 398 >08_01_0254 + 2078380-2078392,2078487-2078578,2079579-2079698, 2079924-2080097,2080184-2080257,2080847-2080927, 2081306-2081366,2081437-2081486,2082278-2082332, 2082599-2082676,2082757-2082810,2083703-2083756, 2083846-2083906,2084229-2084280,2085118-2085184, 2085393-2085452,2085546-2085608,2085752-2085814, 2086337-2086401,2086620-2086688,2086742-2086847 Length = 503 Score = 47.2 bits (107), Expect = 5e-06 Identities = 19/26 (73%), Positives = 23/26 (88%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEE 325 ++SVWIGGSILASL +FQQMW SK + Sbjct: 444 RFSVWIGGSILASLGSFQQMWFSKAD 469 >12_02_1282 + 27528159-27529148,27529549-27529614 Length = 351 Score = 46.0 bits (104), Expect = 1e-05 Identities = 20/30 (66%), Positives = 23/30 (76%) Frame = -1 Query: 372 LASLSTFQQMWISKEEYNESGPGIVHRKCF 283 LA S +MWI+K EY+ESGP IVHRKCF Sbjct: 322 LAPSSMKIKMWIAKAEYDESGPSIVHRKCF 351 >02_04_0473 + 23197294-23197340,23197443-23197680,23197792-23198016, 23198616-23198762,23198827-23198961,23199415-23199507, 23199925-23200044,23200303-23200413,23200486-23200611, 23200731-23200829,23201024-23201104 Length = 473 Score = 38.3 bits (85), Expect = 0.002 Identities = 16/34 (47%), Positives = 22/34 (64%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGI 301 +Y+VW GGS+LAS + F + +K EY E G I Sbjct: 429 RYAVWFGGSVLASTAEFYEACHTKAEYEEYGASI 462 >08_01_0194 - 1603702-1603782,1603970-1604062,1604203-1604328, 1604403-1604513,1604989-1605108,1605665-1605757, 1606024-1606157,1606503-1606530,1606821-1607075, 1607167-1607401,1608147-1608193 Length = 440 Score = 35.1 bits (77), Expect = 0.021 Identities = 15/33 (45%), Positives = 19/33 (57%) Frame = -1 Query: 399 YSVWIGGSILASLSTFQQMWISKEEYNESGPGI 301 Y+ W GGS+ AS F + +KEEY E G I Sbjct: 397 YAAWFGGSVAASNPEFYESCHTKEEYEEHGASI 429 >01_01_1170 - 9318332-9318461,9318551-9318613,9318694-9318744, 9318837-9318921,9319005-9319068,9319139-9319340, 9319808-9320502 Length = 429 Score = 34.3 bits (75), Expect = 0.037 Identities = 16/36 (44%), Positives = 20/36 (55%) Frame = -1 Query: 390 WIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 W GGS+LA F+ M I+K EY E G R+ F Sbjct: 393 WRGGSLLAHRPDFESMCITKSEYEEMGSMRCRRRFF 428 >04_04_1515 + 34117383-34117732,34117833-34117918,34118227-34118297, 34118457-34118524,34118692-34118753,34119010-34119107, 34119545-34119626,34119935-34120077,34120233-34120381, 34120461-34120594,34120714-34120832,34120926-34121014, 34121398-34121515 Length = 522 Score = 28.7 bits (61), Expect = 1.8 Identities = 12/39 (30%), Positives = 24/39 (61%), Gaps = 5/39 (12%) Frame = -1 Query: 396 SVWIGGSILASLSTFQQMW-ISKEEYNE----SGPGIVH 295 S W G +++++STF + W I K+++ + +GP V+ Sbjct: 444 SAWFGAKMISNVSTFTEAWCIKKKQFRQKTRRNGPSFVN 482 >01_01_0292 - 2387653-2387711,2388061-2388684,2388814-2389104, 2389338-2389390,2390496-2390968,2391090-2391432, 2391793-2391911,2392081-2392512,2392657-2392747, 2392833-2392942,2393681-2393875,2394581-2394622, 2395144-2395268,2395856-2395926,2396047-2396147 Length = 1042 Score = 27.9 bits (59), Expect = 3.2 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = -1 Query: 390 WIGGSILASLSTFQQMWISKEEYNESGPGIVHRK 289 W G + A+ S F + S +Y E G + HRK Sbjct: 669 WRGAAAFAASSKFGRHTFSLADYREHGENLFHRK 702 >01_06_1783 + 39845998-39846174,39846260-39846534,39846758-39846891, 39846992-39847116,39847312-39847494,39847610-39847644, 39847756-39847912,39847936-39848049,39848143-39848235, 39848316-39848455,39848606-39848676,39848759-39848839, 39851475-39851954,39852110-39852387,39853346-39854143 Length = 1046 Score = 27.1 bits (57), Expect = 5.6 Identities = 17/52 (32%), Positives = 24/52 (46%), Gaps = 4/52 (7%) Frame = +1 Query: 259 GVTRPRCLEALAVDDAGAGLVVFLLRNPHLLEGGQ----GSQDGSTDPYGVL 402 G++ CL ALA + G+ + +P EGG GS G T P V+ Sbjct: 893 GISVETCLTALATNPNFTGIAIVRTYSPDHYEGGAWNTGGSCTGKTKPLDVV 944 >08_02_0829 - 21604845-21605588 Length = 247 Score = 26.6 bits (56), Expect = 7.3 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = -2 Query: 392 YGSVDPSWLPCPPS 351 + + DPS LPCPPS Sbjct: 229 FSAPDPSMLPCPPS 242 >04_04_1136 - 31142742-31142806,31143245-31143325,31143432-31143588, 31143695-31143809,31144016-31144083,31144171-31144314, 31144393-31144470,31144555-31144637,31144729-31144768, 31144993-31145067,31145202-31145314,31145839-31145878, 31145977-31146128,31146351-31146405,31146717-31146776, 31147005-31147268,31148379-31148436,31148606-31148637 Length = 559 Score = 26.6 bits (56), Expect = 7.3 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = +1 Query: 346 LLEGGQGSQDGSTDPYG 396 LL GGQG++ GS+DP G Sbjct: 202 LLAGGQGTRLGSSDPKG 218 >09_03_0151 - 12794082-12795110 Length = 342 Score = 26.2 bits (55), Expect = 9.7 Identities = 15/43 (34%), Positives = 22/43 (51%) Frame = +1 Query: 265 TRPRCLEALAVDDAGAGLVVFLLRNPHLLEGGQGSQDGSTDPY 393 T +C+ + DAGAG+VV L+ P + G + ST Y Sbjct: 94 TARKCVLSDNAPDAGAGVVVLSLQGPAVWFCRVGGERWSTHTY 136 >05_03_0002 - 7278527-7279675,7279768-7280325,7280433-7280594 Length = 622 Score = 26.2 bits (55), Expect = 9.7 Identities = 17/58 (29%), Positives = 27/58 (46%), Gaps = 2/58 (3%) Frame = +1 Query: 175 DVQFSGITRYNVLTVAFRTRTSTTP--HSTGVTRPRCLEALAVDDAGAGLVVFLLRNP 342 DV+ + + ++V + R++ S P H TRPR + V G VV L +P Sbjct: 19 DVEVTNVASFDVTAPSPRSQPSPRPLPHPNTPTRPRAPSLVRVPRRGGEAVVPPLESP 76 >01_07_0053 + 40772966-40773080,40773484-40773578,40773730-40773843, 40773984-40774088,40774179-40774250,40774293-40774346, 40774507-40774619,40774705-40774839,40774941-40775009, 40775140-40775227,40775327-40775398,40775476-40775576, 40775836-40775953,40776054-40776113,40776206-40776316, 40776499-40776573,40776821-40776854,40777453-40777805, 40778154-40778222,40778526-40778762 Length = 729 Score = 26.2 bits (55), Expect = 9.7 Identities = 13/39 (33%), Positives = 22/39 (56%) Frame = -2 Query: 224 NATVSTLYLVIPEN*TSNLTPSILM*FIVKFYINLISFL 108 N ++ + LV+PE +LTP + FIV I L++ + Sbjct: 310 NIPMADMELVLPEKKNPSLTPMDWVQFIVSVVIGLVTLV 348 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,339,458 Number of Sequences: 37544 Number of extensions: 191542 Number of successful extensions: 472 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 459 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 471 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 694697784 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -