BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30041X (402 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X63432-1|CAA45026.1| 375|Homo sapiens mutant beta-actin (beta'... 86 5e-17 X04098-1|CAA27723.1| 375|Homo sapiens gamma-actin protein. 86 5e-17 X00351-1|CAA25099.1| 375|Homo sapiens protein ( Human mRNA for ... 86 5e-17 V00478-1|CAA23745.1| 124|Homo sapiens protein ( Human mRNA frag... 86 5e-17 M19283-1|AAA51579.1| 375|Homo sapiens ACTG1 protein. 86 5e-17 M10277-1|AAA51567.1| 375|Homo sapiens protein ( Human cytoplasm... 86 5e-17 DQ471327-1|ABF01018.1| 375|Homo sapiens PS1TP5-binding protein ... 86 5e-17 BT019856-1|AAV38659.1| 375|Homo sapiens actin, gamma 1 protein. 86 5e-17 BC053572-1|AAH53572.1| 375|Homo sapiens actin, gamma 1 protein. 86 5e-17 BC023548-1|AAH23548.1| 263|Homo sapiens ACTG1 protein protein. 86 5e-17 BC018774-1|AAH18774.1| 375|Homo sapiens ACTG1 protein protein. 86 5e-17 BC017450-1|AAH17450.1| 363|Homo sapiens Unknown (protein for IM... 86 5e-17 BC016045-1|AAH16045.1| 375|Homo sapiens actin, beta protein. 86 5e-17 BC015779-1|AAH15779.1| 375|Homo sapiens ACTG1 protein protein. 86 5e-17 BC015695-1|AAH15695.1| 375|Homo sapiens actin, gamma 1 protein. 86 5e-17 BC015005-1|AAH15005.1| 375|Homo sapiens ACTG1 protein protein. 86 5e-17 BC014861-1|AAH14861.1| 375|Homo sapiens actin, beta protein. 86 5e-17 BC013380-1|AAH13380.1| 375|Homo sapiens actin, beta protein. 86 5e-17 BC012854-1|AAH12854.1| 360|Homo sapiens ACTB protein protein. 86 5e-17 BC012050-1|AAH12050.1| 375|Homo sapiens actin, gamma 1 protein. 86 5e-17 BC010999-1|AAH10999.1| 375|Homo sapiens actin, gamma 1 protein. 86 5e-17 BC010417-1|AAH10417.2| 165|Homo sapiens ACTG1 protein protein. 86 5e-17 BC009848-1|AAH09848.1| 375|Homo sapiens actin, gamma 1 protein. 86 5e-17 BC009544-1|AAH09544.1| 159|Homo sapiens Unknown (protein for IM... 86 5e-17 BC008633-1|AAH08633.1| 368|Homo sapiens actin, beta protein. 86 5e-17 BC007442-1|AAH07442.1| 375|Homo sapiens actin, gamma 1 protein. 86 5e-17 BC004251-1|AAH04251.1| 375|Homo sapiens actin, beta protein. 86 5e-17 BC002409-1|AAH02409.1| 375|Homo sapiens actin, beta protein. 86 5e-17 BC001920-1|AAH01920.1| 375|Homo sapiens ACTG1 protein protein. 86 5e-17 BC001301-1|AAH01301.1| 375|Homo sapiens actin, beta protein. 86 5e-17 BC000292-1|AAH00292.1| 375|Homo sapiens actin, gamma 1 protein. 86 5e-17 AY582799-1|AAS79319.1| 375|Homo sapiens actin, beta protein. 86 5e-17 AK223032-1|BAD96752.1| 375|Homo sapiens beta actin variant prot... 86 5e-17 AC006483-1|AAP22343.1| 375|Homo sapiens unknown protein. 86 5e-17 AK222925-1|BAD96645.1| 375|Homo sapiens beta actin variant prot... 85 6e-17 X13839-1|CAA32064.1| 377|Homo sapiens protein ( Human mRNA for ... 85 1e-16 M33216-1|AAA60560.1| 47|Homo sapiens smooth muscle alpha-actin... 85 1e-16 J05192-1|AAA51577.1| 377|Homo sapiens ACTA3 protein. 85 1e-16 J00073-1|AAB59619.1| 377|Homo sapiens alpha-cardiac actin protein. 85 1e-16 CR541795-1|CAG46594.1| 377|Homo sapiens ACTC protein. 85 1e-16 CR536518-1|CAG38756.1| 377|Homo sapiens ACTA2 protein. 85 1e-16 BC093052-1|AAH93052.1| 377|Homo sapiens actin, alpha 2, smooth ... 85 1e-16 BC017554-1|AAH17554.1| 377|Homo sapiens actin, alpha 2, smooth ... 85 1e-16 BC009978-1|AAH09978.1| 377|Homo sapiens actin, alpha, cardiac m... 85 1e-16 AY692464-1|AAW29811.1| 377|Homo sapiens growth-inhibiting gene ... 85 1e-16 AL157394-6|CAI13864.1| 377|Homo sapiens actin, alpha 2, smooth ... 85 1e-16 X16940-1|CAA34814.1| 376|Homo sapiens protein ( Human mRNA for ... 83 3e-16 M20543-1|AAA60296.1| 377|Homo sapiens ACTA1 protein. 83 3e-16 M16247-1|AAA51580.1| 232|Homo sapiens ACTG1 protein. 83 3e-16 J00068-1|AAB59376.1| 377|Homo sapiens ACTA1 protein. 83 3e-16 D00654-1|BAA00546.1| 376|Homo sapiens enteric smooth muscle gam... 83 3e-16 CR541796-1|CAG46595.1| 377|Homo sapiens ACTA1 protein. 83 3e-16 CR541794-1|CAG46593.1| 376|Homo sapiens ACTG2 protein. 83 3e-16 CR536516-1|CAG38754.1| 377|Homo sapiens ACTA1 protein. 83 3e-16 CR536515-1|CAG38753.1| 376|Homo sapiens ACTG2 protein. 83 3e-16 BC094877-1|AAH94877.1| 376|Homo sapiens ACTG2 protein protein. 83 3e-16 BC012617-1|AAH12617.1| 376|Homo sapiens actin, gamma 2, smooth ... 83 3e-16 BC012597-1|AAH12597.1| 377|Homo sapiens actin, alpha 1, skeleta... 83 3e-16 AY280960-1|AAP37280.1| 254|Homo sapiens actin alpha 1 skeletal ... 83 3e-16 AL160004-6|CAI19050.1| 377|Homo sapiens actin, alpha 1, skeleta... 83 3e-16 AL160004-5|CAI19052.1| 342|Homo sapiens actin, alpha 1, skeleta... 83 3e-16 AL160004-4|CAI19051.1| 287|Homo sapiens actin, alpha 1, skeleta... 83 3e-16 AF182035-1|AAF02694.1| 377|Homo sapiens skeletal muscle alpha-a... 83 3e-16 AC073046-2|AAX88909.1| 376|Homo sapiens unknown protein. 83 3e-16 EF523384-1|ABP57734.1| 1075|Homo sapiens POTE-2 alpha-actin prot... 83 3e-16 AK223055-1|BAD96775.1| 375|Homo sapiens beta actin variant prot... 83 3e-16 BC092424-1|AAH92424.1| 219|Homo sapiens Unknown (protein for MG... 80 2e-15 BC020944-1|AAH20944.1| 426|Homo sapiens actin-like 6B protein. 66 3e-11 AF041475-1|AAD54678.1| 426|Homo sapiens BAF53b protein. 66 3e-11 AC099394-1|AAP21874.1| 426|Homo sapiens unknown protein. 66 3e-11 AB015906-1|BAA74576.1| 426|Homo sapiens actin-related protein h... 66 3e-11 CR533529-1|CAG38560.1| 429|Homo sapiens BAF53A protein. 65 7e-11 BC036371-1|AAH36371.1| 429|Homo sapiens actin-like 6A protein. 65 7e-11 BC007289-1|AAH07289.1| 372|Homo sapiens actin related protein M... 65 7e-11 BC001391-1|AAH01391.1| 429|Homo sapiens actin-like 6A protein. 65 7e-11 BC000949-1|AAH00949.1| 387|Homo sapiens actin-like 6A protein. 65 7e-11 AK223212-1|BAD96932.1| 429|Homo sapiens actin-like 6A isoform 1... 65 7e-11 AK055346-1|BAB70906.1| 372|Homo sapiens protein ( Homo sapiens ... 65 7e-11 AF041474-1|AAC94991.1| 429|Homo sapiens BAF53a protein. 65 7e-11 AB061315-1|BAB87848.1| 387|Homo sapiens hArpNbeta-s protein. 65 7e-11 AB060168-1|BAB87844.1| 387|Homo sapiens hArpNbeta-s protein. 65 7e-11 AB049117-1|BAB39481.1| 372|Homo sapiens actin related protein p... 65 7e-11 AB015907-1|BAA74577.1| 429|Homo sapiens actin-related protein h... 65 7e-11 X82207-1|CAA57691.1| 376|Homo sapiens beta-centracetin protein. 64 2e-10 BC010090-1|AAH10090.1| 376|Homo sapiens ARP1 actin-related prot... 64 2e-10 BC006372-1|AAH06372.1| 376|Homo sapiens ARP1 actin-related prot... 64 2e-10 BC004374-1|AAH04374.1| 376|Homo sapiens ARP1 actin-related prot... 64 2e-10 AC017099-2|AAY24280.1| 376|Homo sapiens unknown protein. 64 2e-10 Z14978-1|CAA78701.1| 376|Homo sapiens actin-related protein pro... 64 2e-10 X82206-1|CAA57690.1| 376|Homo sapiens alpha-centractin protein. 64 2e-10 BC026016-1|AAH26016.1| 376|Homo sapiens ARP1 actin-related prot... 64 2e-10 BC000693-1|AAH00693.1| 376|Homo sapiens ARP1 actin-related prot... 64 2e-10 AL121928-12|CAC08404.1| 376|Homo sapiens ARP1 actin-related pro... 64 2e-10 BC045752-1|AAH45752.1| 416|Homo sapiens hypothetical protein MG... 63 4e-10 BC024028-1|AAH24028.1| 416|Homo sapiens hypothetical protein MG... 63 4e-10 BC033789-1|AAH33789.1| 415|Homo sapiens actin-like 7B protein. 58 1e-08 AL359692-3|CAI40570.1| 415|Homo sapiens actin-like 7B protein. 58 1e-08 AF113527-1|AAD44110.1| 415|Homo sapiens actin-like-7-beta protein. 58 1e-08 AB284521-1|BAF41972.1| 415|Homo sapiens t-actin 1 protein. 58 1e-08 DQ407611-1|ABD66582.1| 151|Homo sapiens beta-actin protein. 55 8e-08 BC014610-1|AAH14610.1| 435|Homo sapiens actin-like 7A protein. 54 2e-07 AL359692-4|CAI40571.1| 435|Homo sapiens actin-like 7A protein. 54 2e-07 AF113526-1|AAD44109.1| 435|Homo sapiens actin-like-7-alpha prot... 54 2e-07 AB284520-1|BAF41971.1| 435|Homo sapiens human t-actin 2 protein. 54 2e-07 Z74696-1|CAI42428.1| 376|Homo sapiens actin-related protein T1 ... 53 3e-07 BC029499-1|AAH29499.1| 376|Homo sapiens actin-related protein T... 53 3e-07 BC014597-1|AAH14597.1| 376|Homo sapiens actin-related protein T... 53 3e-07 AL356984-1|CAH72587.1| 377|Homo sapiens actin-related protein M... 53 3e-07 AF440740-1|AAM00433.1| 377|Homo sapiens actin-related protein T... 53 3e-07 AF440739-1|AAM00432.1| 376|Homo sapiens actin-related protein T... 53 3e-07 AB057364-1|BAB85862.1| 377|Homo sapiens actin-related protein h... 53 3e-07 BC028909-1|AAH28909.1| 366|Homo sapiens actin-like 8 protein. 44 1e-04 AL136529-1|CAC15940.1| 366|Homo sapiens actin-like 8 protein. 44 1e-04 AK057339-1|BAB71434.1| 366|Homo sapiens protein ( Homo sapiens ... 44 1e-04 BC044590-1|AAH44590.1| 418|Homo sapiens ARP3 actin-related prot... 42 0.001 AF127773-1|AAD51904.1| 418|Homo sapiens unknown protein. 42 0.001 AF006083-1|AAB64188.1| 418|Homo sapiens Arp3 protein. 42 0.001 AC110769-1|AAX93226.1| 418|Homo sapiens unknown protein. 42 0.001 AB209353-1|BAD92590.1| 369|Homo sapiens ARP3 actin-related prot... 42 0.001 X82208-1|CAA57692.1| 329|Homo sapiens beta-centractin protein. 41 0.002 BC008682-1|AAH08682.1| 418|Homo sapiens ARP3 actin-related prot... 41 0.002 AF023453-1|AAC98904.1| 418|Homo sapiens actin-related protein 3... 41 0.002 AB209174-1|BAD92411.1| 282|Homo sapiens actin-related protein 3... 41 0.002 AL121906-3|CAI22126.1| 245|Homo sapiens chromosome 20 open read... 40 0.002 BC032744-1|AAH32744.1| 329|Homo sapiens ACTR8 protein protein. 33 0.36 AK026232-1|BAB15402.1| 374|Homo sapiens protein ( Homo sapiens ... 33 0.36 AK022996-1|BAB14352.1| 624|Homo sapiens protein ( Homo sapiens ... 33 0.36 BC015107-1|AAH15107.1| 396|Homo sapiens ARP6 actin-related prot... 31 1.1 AK222959-1|BAD96679.1| 396|Homo sapiens ARP6 actin-related prot... 31 1.1 AK023684-1|BAB14640.1| 288|Homo sapiens protein ( Homo sapiens ... 31 1.1 AK023495-1|BAB14588.1| 396|Homo sapiens protein ( Homo sapiens ... 31 1.1 AF330055-1|AAK94199.1| 430|Homo sapiens neuropeptide NPVF recep... 31 1.1 AF212251-1|AAK14934.1| 396|Homo sapiens CDA12 protein. 31 1.1 AB038229-1|BAB20762.1| 396|Homo sapiens hARPX protein. 31 1.1 BC036253-1|AAH36253.1| 339|Homo sapiens ACTR2 protein protein. 31 1.9 BC014546-1|AAH14546.1| 394|Homo sapiens ARP2 actin-related prot... 31 1.9 AF006082-1|AAB64187.1| 394|Homo sapiens Arp2 protein. 31 1.9 BC131580-1|AAI31581.1| 430|Homo sapiens neuropeptide FF recepto... 30 3.3 AL355138-1|CAI12599.1| 428|Homo sapiens neuropeptide FF recepto... 30 3.3 AF268898-1|AAG41397.1| 430|Homo sapiens neuropeptide FF recepto... 30 3.3 AB065729-1|BAC05950.1| 441|Homo sapiens seven transmembrane hel... 30 3.3 AB040104-1|BAB17677.1| 430|Homo sapiens RFamide-related peptide... 30 3.3 BC047635-1|AAH47635.1| 404|Homo sapiens SLC39A12 protein protein. 29 7.7 AF053356-5|AAC78795.1| 475|Homo sapiens actin like gene protein. 29 7.7 >X63432-1|CAA45026.1| 375|Homo sapiens mutant beta-actin (beta'-actin) protein. Length = 375 Score = 85.8 bits (203), Expect = 5e-17 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 KYSVWIGGSILASLSTFQQMWISK+EY+ESGP IVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375 >X04098-1|CAA27723.1| 375|Homo sapiens gamma-actin protein. Length = 375 Score = 85.8 bits (203), Expect = 5e-17 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 KYSVWIGGSILASLSTFQQMWISK+EY+ESGP IVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375 >X00351-1|CAA25099.1| 375|Homo sapiens protein ( Human mRNA for beta-actin. ). Length = 375 Score = 85.8 bits (203), Expect = 5e-17 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 KYSVWIGGSILASLSTFQQMWISK+EY+ESGP IVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375 >V00478-1|CAA23745.1| 124|Homo sapiens protein ( Human mRNA fragment encoding cytoplasmic actin. (isolated from cultured epidermal cells grown from human foreskin). ). Length = 124 Score = 85.8 bits (203), Expect = 5e-17 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 KYSVWIGGSILASLSTFQQMWISK+EY+ESGP IVHRKCF Sbjct: 85 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 124 >M19283-1|AAA51579.1| 375|Homo sapiens ACTG1 protein. Length = 375 Score = 85.8 bits (203), Expect = 5e-17 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 KYSVWIGGSILASLSTFQQMWISK+EY+ESGP IVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375 >M10277-1|AAA51567.1| 375|Homo sapiens protein ( Human cytoplasmic beta-actin gene, complete cds. ). Length = 375 Score = 85.8 bits (203), Expect = 5e-17 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 KYSVWIGGSILASLSTFQQMWISK+EY+ESGP IVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375 >DQ471327-1|ABF01018.1| 375|Homo sapiens PS1TP5-binding protein 1 protein. Length = 375 Score = 85.8 bits (203), Expect = 5e-17 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 KYSVWIGGSILASLSTFQQMWISK+EY+ESGP IVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375 >BT019856-1|AAV38659.1| 375|Homo sapiens actin, gamma 1 protein. Length = 375 Score = 85.8 bits (203), Expect = 5e-17 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 KYSVWIGGSILASLSTFQQMWISK+EY+ESGP IVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375 >BC053572-1|AAH53572.1| 375|Homo sapiens actin, gamma 1 protein. Length = 375 Score = 85.8 bits (203), Expect = 5e-17 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 KYSVWIGGSILASLSTFQQMWISK+EY+ESGP IVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375 >BC023548-1|AAH23548.1| 263|Homo sapiens ACTG1 protein protein. Length = 263 Score = 85.8 bits (203), Expect = 5e-17 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 KYSVWIGGSILASLSTFQQMWISK+EY+ESGP IVHRKCF Sbjct: 224 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 263 >BC018774-1|AAH18774.1| 375|Homo sapiens ACTG1 protein protein. Length = 375 Score = 85.8 bits (203), Expect = 5e-17 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 KYSVWIGGSILASLSTFQQMWISK+EY+ESGP IVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375 >BC017450-1|AAH17450.1| 363|Homo sapiens Unknown (protein for IMAGE:3538275) protein. Length = 363 Score = 85.8 bits (203), Expect = 5e-17 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 KYSVWIGGSILASLSTFQQMWISK+EY+ESGP IVHRKCF Sbjct: 324 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 363 >BC016045-1|AAH16045.1| 375|Homo sapiens actin, beta protein. Length = 375 Score = 85.8 bits (203), Expect = 5e-17 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 KYSVWIGGSILASLSTFQQMWISK+EY+ESGP IVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375 >BC015779-1|AAH15779.1| 375|Homo sapiens ACTG1 protein protein. Length = 375 Score = 85.8 bits (203), Expect = 5e-17 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 KYSVWIGGSILASLSTFQQMWISK+EY+ESGP IVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375 >BC015695-1|AAH15695.1| 375|Homo sapiens actin, gamma 1 protein. Length = 375 Score = 85.8 bits (203), Expect = 5e-17 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 KYSVWIGGSILASLSTFQQMWISK+EY+ESGP IVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375 >BC015005-1|AAH15005.1| 375|Homo sapiens ACTG1 protein protein. Length = 375 Score = 85.8 bits (203), Expect = 5e-17 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 KYSVWIGGSILASLSTFQQMWISK+EY+ESGP IVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375 >BC014861-1|AAH14861.1| 375|Homo sapiens actin, beta protein. Length = 375 Score = 85.8 bits (203), Expect = 5e-17 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 KYSVWIGGSILASLSTFQQMWISK+EY+ESGP IVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375 >BC013380-1|AAH13380.1| 375|Homo sapiens actin, beta protein. Length = 375 Score = 85.8 bits (203), Expect = 5e-17 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 KYSVWIGGSILASLSTFQQMWISK+EY+ESGP IVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375 >BC012854-1|AAH12854.1| 360|Homo sapiens ACTB protein protein. Length = 360 Score = 85.8 bits (203), Expect = 5e-17 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 KYSVWIGGSILASLSTFQQMWISK+EY+ESGP IVHRKCF Sbjct: 321 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 360 >BC012050-1|AAH12050.1| 375|Homo sapiens actin, gamma 1 protein. Length = 375 Score = 85.8 bits (203), Expect = 5e-17 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 KYSVWIGGSILASLSTFQQMWISK+EY+ESGP IVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375 >BC010999-1|AAH10999.1| 375|Homo sapiens actin, gamma 1 protein. Length = 375 Score = 85.8 bits (203), Expect = 5e-17 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 KYSVWIGGSILASLSTFQQMWISK+EY+ESGP IVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375 >BC010417-1|AAH10417.2| 165|Homo sapiens ACTG1 protein protein. Length = 165 Score = 85.8 bits (203), Expect = 5e-17 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 KYSVWIGGSILASLSTFQQMWISK+EY+ESGP IVHRKCF Sbjct: 126 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 165 >BC009848-1|AAH09848.1| 375|Homo sapiens actin, gamma 1 protein. Length = 375 Score = 85.8 bits (203), Expect = 5e-17 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 KYSVWIGGSILASLSTFQQMWISK+EY+ESGP IVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375 >BC009544-1|AAH09544.1| 159|Homo sapiens Unknown (protein for IMAGE:3897065) protein. Length = 159 Score = 85.8 bits (203), Expect = 5e-17 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 KYSVWIGGSILASLSTFQQMWISK+EY+ESGP IVHRKCF Sbjct: 120 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 159 >BC008633-1|AAH08633.1| 368|Homo sapiens actin, beta protein. Length = 368 Score = 85.8 bits (203), Expect = 5e-17 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 KYSVWIGGSILASLSTFQQMWISK+EY+ESGP IVHRKCF Sbjct: 329 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 368 >BC007442-1|AAH07442.1| 375|Homo sapiens actin, gamma 1 protein. Length = 375 Score = 85.8 bits (203), Expect = 5e-17 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 KYSVWIGGSILASLSTFQQMWISK+EY+ESGP IVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375 >BC004251-1|AAH04251.1| 375|Homo sapiens actin, beta protein. Length = 375 Score = 85.8 bits (203), Expect = 5e-17 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 KYSVWIGGSILASLSTFQQMWISK+EY+ESGP IVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375 >BC002409-1|AAH02409.1| 375|Homo sapiens actin, beta protein. Length = 375 Score = 85.8 bits (203), Expect = 5e-17 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 KYSVWIGGSILASLSTFQQMWISK+EY+ESGP IVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375 >BC001920-1|AAH01920.1| 375|Homo sapiens ACTG1 protein protein. Length = 375 Score = 85.8 bits (203), Expect = 5e-17 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 KYSVWIGGSILASLSTFQQMWISK+EY+ESGP IVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375 >BC001301-1|AAH01301.1| 375|Homo sapiens actin, beta protein. Length = 375 Score = 85.8 bits (203), Expect = 5e-17 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 KYSVWIGGSILASLSTFQQMWISK+EY+ESGP IVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375 >BC000292-1|AAH00292.1| 375|Homo sapiens actin, gamma 1 protein. Length = 375 Score = 85.8 bits (203), Expect = 5e-17 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 KYSVWIGGSILASLSTFQQMWISK+EY+ESGP IVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375 >AY582799-1|AAS79319.1| 375|Homo sapiens actin, beta protein. Length = 375 Score = 85.8 bits (203), Expect = 5e-17 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 KYSVWIGGSILASLSTFQQMWISK+EY+ESGP IVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375 >AK223032-1|BAD96752.1| 375|Homo sapiens beta actin variant protein. Length = 375 Score = 85.8 bits (203), Expect = 5e-17 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 KYSVWIGGSILASLSTFQQMWISK+EY+ESGP IVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375 >AC006483-1|AAP22343.1| 375|Homo sapiens unknown protein. Length = 375 Score = 85.8 bits (203), Expect = 5e-17 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 KYSVWIGGSILASLSTFQQMWISK+EY+ESGP IVHRKCF Sbjct: 336 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375 >AK222925-1|BAD96645.1| 375|Homo sapiens beta actin variant protein. Length = 375 Score = 85.4 bits (202), Expect = 6e-17 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 KYSVWIGGS+LASLSTFQQMWISK+EY+ESGP IVHRKCF Sbjct: 336 KYSVWIGGSVLASLSTFQQMWISKQEYDESGPSIVHRKCF 375 >X13839-1|CAA32064.1| 377|Homo sapiens protein ( Human mRNA for vascular smooth muscle alpha-actin. ). Length = 377 Score = 84.6 bits (200), Expect = 1e-16 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 KYSVWIGGSILASLSTFQQMWISK+EY+E+GP IVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF 377 >M33216-1|AAA60560.1| 47|Homo sapiens smooth muscle alpha-actin protein. Length = 47 Score = 84.6 bits (200), Expect = 1e-16 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 KYSVWIGGSILASLSTFQQMWISK+EY+E+GP IVHRKCF Sbjct: 8 KYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF 47 >J05192-1|AAA51577.1| 377|Homo sapiens ACTA3 protein. Length = 377 Score = 84.6 bits (200), Expect = 1e-16 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 KYSVWIGGSILASLSTFQQMWISK+EY+E+GP IVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF 377 >J00073-1|AAB59619.1| 377|Homo sapiens alpha-cardiac actin protein. Length = 377 Score = 84.6 bits (200), Expect = 1e-16 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 KYSVWIGGSILASLSTFQQMWISK+EY+E+GP IVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF 377 >CR541795-1|CAG46594.1| 377|Homo sapiens ACTC protein. Length = 377 Score = 84.6 bits (200), Expect = 1e-16 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 KYSVWIGGSILASLSTFQQMWISK+EY+E+GP IVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF 377 >CR536518-1|CAG38756.1| 377|Homo sapiens ACTA2 protein. Length = 377 Score = 84.6 bits (200), Expect = 1e-16 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 KYSVWIGGSILASLSTFQQMWISK+EY+E+GP IVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF 377 >BC093052-1|AAH93052.1| 377|Homo sapiens actin, alpha 2, smooth muscle, aorta protein. Length = 377 Score = 84.6 bits (200), Expect = 1e-16 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 KYSVWIGGSILASLSTFQQMWISK+EY+E+GP IVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF 377 >BC017554-1|AAH17554.1| 377|Homo sapiens actin, alpha 2, smooth muscle, aorta protein. Length = 377 Score = 84.6 bits (200), Expect = 1e-16 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 KYSVWIGGSILASLSTFQQMWISK+EY+E+GP IVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF 377 >BC009978-1|AAH09978.1| 377|Homo sapiens actin, alpha, cardiac muscle 1 protein. Length = 377 Score = 84.6 bits (200), Expect = 1e-16 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 KYSVWIGGSILASLSTFQQMWISK+EY+E+GP IVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF 377 >AY692464-1|AAW29811.1| 377|Homo sapiens growth-inhibiting gene 46 protein. Length = 377 Score = 84.6 bits (200), Expect = 1e-16 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 KYSVWIGGSILASLSTFQQMWISK+EY+E+GP IVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF 377 >AL157394-6|CAI13864.1| 377|Homo sapiens actin, alpha 2, smooth muscle, aorta protein. Length = 377 Score = 84.6 bits (200), Expect = 1e-16 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 KYSVWIGGSILASLSTFQQMWISK+EY+E+GP IVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF 377 >X16940-1|CAA34814.1| 376|Homo sapiens protein ( Human mRNA for enteric smooth muscle gamma-actin. ). Length = 376 Score = 83.4 bits (197), Expect = 3e-16 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 KYSVWIGGSILASLSTFQQMWISK EY+E+GP IVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKPEYDEAGPSIVHRKCF 376 >M20543-1|AAA60296.1| 377|Homo sapiens ACTA1 protein. Length = 377 Score = 83.4 bits (197), Expect = 3e-16 Identities = 35/40 (87%), Positives = 39/40 (97%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 KYSVWIGGSILASLSTFQQMWI+K+EY+E+GP IVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWITKQEYDEAGPSIVHRKCF 377 >M16247-1|AAA51580.1| 232|Homo sapiens ACTG1 protein. Length = 232 Score = 83.4 bits (197), Expect = 3e-16 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 KYSVWIGG ILASLSTFQQMWISK+EY+ESGP IVHRKCF Sbjct: 193 KYSVWIGGFILASLSTFQQMWISKQEYDESGPSIVHRKCF 232 >J00068-1|AAB59376.1| 377|Homo sapiens ACTA1 protein. Length = 377 Score = 83.4 bits (197), Expect = 3e-16 Identities = 35/40 (87%), Positives = 39/40 (97%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 KYSVWIGGSILASLSTFQQMWI+K+EY+E+GP IVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWITKQEYDEAGPSIVHRKCF 377 >D00654-1|BAA00546.1| 376|Homo sapiens enteric smooth muscle gamma-actin protein. Length = 376 Score = 83.4 bits (197), Expect = 3e-16 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 KYSVWIGGSILASLSTFQQMWISK EY+E+GP IVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKPEYDEAGPSIVHRKCF 376 >CR541796-1|CAG46595.1| 377|Homo sapiens ACTA1 protein. Length = 377 Score = 83.4 bits (197), Expect = 3e-16 Identities = 35/40 (87%), Positives = 39/40 (97%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 KYSVWIGGSILASLSTFQQMWI+K+EY+E+GP IVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWITKQEYDEAGPSIVHRKCF 377 >CR541794-1|CAG46593.1| 376|Homo sapiens ACTG2 protein. Length = 376 Score = 83.4 bits (197), Expect = 3e-16 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 KYSVWIGGSILASLSTFQQMWISK EY+E+GP IVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKPEYDEAGPSIVHRKCF 376 >CR536516-1|CAG38754.1| 377|Homo sapiens ACTA1 protein. Length = 377 Score = 83.4 bits (197), Expect = 3e-16 Identities = 35/40 (87%), Positives = 39/40 (97%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 KYSVWIGGSILASLSTFQQMWI+K+EY+E+GP IVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWITKQEYDEAGPSIVHRKCF 377 >CR536515-1|CAG38753.1| 376|Homo sapiens ACTG2 protein. Length = 376 Score = 83.4 bits (197), Expect = 3e-16 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 KYSVWIGGSILASLSTFQQMWISK EY+E+GP IVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKPEYDEAGPSIVHRKCF 376 >BC094877-1|AAH94877.1| 376|Homo sapiens ACTG2 protein protein. Length = 376 Score = 83.4 bits (197), Expect = 3e-16 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 KYSVWIGGSILASLSTFQQMWISK EY+E+GP IVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKPEYDEAGPSIVHRKCF 376 >BC012617-1|AAH12617.1| 376|Homo sapiens actin, gamma 2, smooth muscle, enteric protein. Length = 376 Score = 83.4 bits (197), Expect = 3e-16 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 KYSVWIGGSILASLSTFQQMWISK EY+E+GP IVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKPEYDEAGPSIVHRKCF 376 >BC012597-1|AAH12597.1| 377|Homo sapiens actin, alpha 1, skeletal muscle protein. Length = 377 Score = 83.4 bits (197), Expect = 3e-16 Identities = 35/40 (87%), Positives = 39/40 (97%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 KYSVWIGGSILASLSTFQQMWI+K+EY+E+GP IVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWITKQEYDEAGPSIVHRKCF 377 >AY280960-1|AAP37280.1| 254|Homo sapiens actin alpha 1 skeletal muscle protein protein. Length = 254 Score = 83.4 bits (197), Expect = 3e-16 Identities = 35/40 (87%), Positives = 39/40 (97%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 KYSVWIGGSILASLSTFQQMWI+K+EY+E+GP IVHRKCF Sbjct: 215 KYSVWIGGSILASLSTFQQMWITKQEYDEAGPSIVHRKCF 254 >AL160004-6|CAI19050.1| 377|Homo sapiens actin, alpha 1, skeletal muscle protein. Length = 377 Score = 83.4 bits (197), Expect = 3e-16 Identities = 35/40 (87%), Positives = 39/40 (97%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 KYSVWIGGSILASLSTFQQMWI+K+EY+E+GP IVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWITKQEYDEAGPSIVHRKCF 377 >AL160004-5|CAI19052.1| 342|Homo sapiens actin, alpha 1, skeletal muscle protein. Length = 342 Score = 83.4 bits (197), Expect = 3e-16 Identities = 35/40 (87%), Positives = 39/40 (97%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 KYSVWIGGSILASLSTFQQMWI+K+EY+E+GP IVHRKCF Sbjct: 303 KYSVWIGGSILASLSTFQQMWITKQEYDEAGPSIVHRKCF 342 >AL160004-4|CAI19051.1| 287|Homo sapiens actin, alpha 1, skeletal muscle protein. Length = 287 Score = 83.4 bits (197), Expect = 3e-16 Identities = 35/40 (87%), Positives = 39/40 (97%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 KYSVWIGGSILASLSTFQQMWI+K+EY+E+GP IVHRKCF Sbjct: 248 KYSVWIGGSILASLSTFQQMWITKQEYDEAGPSIVHRKCF 287 >AF182035-1|AAF02694.1| 377|Homo sapiens skeletal muscle alpha-actin precursor protein. Length = 377 Score = 83.4 bits (197), Expect = 3e-16 Identities = 35/40 (87%), Positives = 39/40 (97%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 KYSVWIGGSILASLSTFQQMWI+K+EY+E+GP IVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWITKQEYDEAGPSIVHRKCF 377 >AC073046-2|AAX88909.1| 376|Homo sapiens unknown protein. Length = 376 Score = 83.4 bits (197), Expect = 3e-16 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 KYSVWIGGSILASLSTFQQMWISK EY+E+GP IVHRKCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKPEYDEAGPSIVHRKCF 376 >EF523384-1|ABP57734.1| 1075|Homo sapiens POTE-2 alpha-actin protein. Length = 1075 Score = 83.0 bits (196), Expect = 3e-16 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKC 286 KYSVW+GGSILASLSTFQQMWISK+EY+ESGP IVHRKC Sbjct: 1036 KYSVWVGGSILASLSTFQQMWISKQEYDESGPSIVHRKC 1074 >AK223055-1|BAD96775.1| 375|Homo sapiens beta actin variant protein. Length = 375 Score = 83.0 bits (196), Expect = 3e-16 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 KYSVWIGGSI ASLSTFQQMWISK+EY+ESGP IVHRKCF Sbjct: 336 KYSVWIGGSIPASLSTFQQMWISKQEYDESGPSIVHRKCF 375 >BC092424-1|AAH92424.1| 219|Homo sapiens Unknown (protein for MGC:102982) protein. Length = 219 Score = 80.2 bits (189), Expect = 2e-15 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 KYSVWI GSILASLSTFQQMWISK+EY+ES P IVHRKCF Sbjct: 180 KYSVWIRGSILASLSTFQQMWISKQEYSESSPSIVHRKCF 219 >BC020944-1|AAH20944.1| 426|Homo sapiens actin-like 6B protein. Length = 426 Score = 66.5 bits (155), Expect = 3e-11 Identities = 29/39 (74%), Positives = 31/39 (79%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKC 286 K+S WIGGSILASL TFQQMWISK+EY E G V RKC Sbjct: 387 KFSPWIGGSILASLGTFQQMWISKQEYEEGGKQCVERKC 425 >AF041475-1|AAD54678.1| 426|Homo sapiens BAF53b protein. Length = 426 Score = 66.5 bits (155), Expect = 3e-11 Identities = 29/39 (74%), Positives = 31/39 (79%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKC 286 K+S WIGGSILASL TFQQMWISK+EY E G V RKC Sbjct: 387 KFSPWIGGSILASLGTFQQMWISKQEYEEGGKQCVERKC 425 >AC099394-1|AAP21874.1| 426|Homo sapiens unknown protein. Length = 426 Score = 66.5 bits (155), Expect = 3e-11 Identities = 29/39 (74%), Positives = 31/39 (79%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKC 286 K+S WIGGSILASL TFQQMWISK+EY E G V RKC Sbjct: 387 KFSPWIGGSILASLGTFQQMWISKQEYEEGGKQCVERKC 425 >AB015906-1|BAA74576.1| 426|Homo sapiens actin-related protein hArpN alpha protein. Length = 426 Score = 66.5 bits (155), Expect = 3e-11 Identities = 29/39 (74%), Positives = 31/39 (79%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKC 286 K+S WIGGSILASL TFQQMWISK+EY E G V RKC Sbjct: 387 KFSPWIGGSILASLGTFQQMWISKQEYEEGGKQCVERKC 425 >CR533529-1|CAG38560.1| 429|Homo sapiens BAF53A protein. Length = 429 Score = 65.3 bits (152), Expect = 7e-11 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKC 286 ++S WIGGSILASL TFQQMWISK+EY E G V RKC Sbjct: 390 RFSSWIGGSILASLGTFQQMWISKQEYEEGGKQCVERKC 428 >BC036371-1|AAH36371.1| 429|Homo sapiens actin-like 6A protein. Length = 429 Score = 65.3 bits (152), Expect = 7e-11 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKC 286 ++S WIGGSILASL TFQQMWISK+EY E G V RKC Sbjct: 390 RFSSWIGGSILASLGTFQQMWISKQEYEEGGKQCVERKC 428 >BC007289-1|AAH07289.1| 372|Homo sapiens actin related protein M1 protein. Length = 372 Score = 65.3 bits (152), Expect = 7e-11 Identities = 27/40 (67%), Positives = 32/40 (80%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 K SVW+GGSILASLS FQ MWI+ E+ E GP IVH++CF Sbjct: 333 KISVWMGGSILASLSAFQDMWITAAEFKEVGPNIVHQRCF 372 >BC001391-1|AAH01391.1| 429|Homo sapiens actin-like 6A protein. Length = 429 Score = 65.3 bits (152), Expect = 7e-11 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKC 286 ++S WIGGSILASL TFQQMWISK+EY E G V RKC Sbjct: 390 RFSSWIGGSILASLGTFQQMWISKQEYEEGGKQCVERKC 428 >BC000949-1|AAH00949.1| 387|Homo sapiens actin-like 6A protein. Length = 387 Score = 65.3 bits (152), Expect = 7e-11 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKC 286 ++S WIGGSILASL TFQQMWISK+EY E G V RKC Sbjct: 348 RFSSWIGGSILASLGTFQQMWISKQEYEEGGKQCVERKC 386 >AK223212-1|BAD96932.1| 429|Homo sapiens actin-like 6A isoform 1 variant protein. Length = 429 Score = 65.3 bits (152), Expect = 7e-11 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKC 286 ++S WIGGSILASL TFQQMWISK+EY E G V RKC Sbjct: 390 RFSSWIGGSILASLGTFQQMWISKQEYEEGGKQCVERKC 428 >AK055346-1|BAB70906.1| 372|Homo sapiens protein ( Homo sapiens cDNA FLJ30784 fis, clone FEBRA2000881, moderately similar to ACTIN 6. ). Length = 372 Score = 65.3 bits (152), Expect = 7e-11 Identities = 27/40 (67%), Positives = 32/40 (80%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 K SVW+GGSILASLS FQ MWI+ E+ E GP IVH++CF Sbjct: 333 KISVWMGGSILASLSAFQDMWITAAEFKEVGPNIVHQRCF 372 >AF041474-1|AAC94991.1| 429|Homo sapiens BAF53a protein. Length = 429 Score = 65.3 bits (152), Expect = 7e-11 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKC 286 ++S WIGGSILASL TFQQMWISK+EY E G V RKC Sbjct: 390 RFSSWIGGSILASLGTFQQMWISKQEYEEGGKQCVERKC 428 >AB061315-1|BAB87848.1| 387|Homo sapiens hArpNbeta-s protein. Length = 387 Score = 65.3 bits (152), Expect = 7e-11 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKC 286 ++S WIGGSILASL TFQQMWISK+EY E G V RKC Sbjct: 348 RFSSWIGGSILASLGTFQQMWISKQEYEEGGKQCVERKC 386 >AB060168-1|BAB87844.1| 387|Homo sapiens hArpNbeta-s protein. Length = 387 Score = 65.3 bits (152), Expect = 7e-11 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKC 286 ++S WIGGSILASL TFQQMWISK+EY E G V RKC Sbjct: 348 RFSSWIGGSILASLGTFQQMWISKQEYEEGGKQCVERKC 386 >AB049117-1|BAB39481.1| 372|Homo sapiens actin related protein protein. Length = 372 Score = 65.3 bits (152), Expect = 7e-11 Identities = 27/40 (67%), Positives = 32/40 (80%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 K SVW+GGSILASLS FQ MWI+ E+ E GP IVH++CF Sbjct: 333 KISVWMGGSILASLSAFQDMWITAAEFKEVGPNIVHQRCF 372 >AB015907-1|BAA74577.1| 429|Homo sapiens actin-related protein hArpN beta protein. Length = 429 Score = 65.3 bits (152), Expect = 7e-11 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKC 286 ++S WIGGSILASL TFQQMWISK+EY E G V RKC Sbjct: 390 RFSSWIGGSILASLGTFQQMWISKQEYEEGGKQCVERKC 428 >X82207-1|CAA57691.1| 376|Homo sapiens beta-centracetin protein. Length = 376 Score = 64.1 bits (149), Expect = 2e-10 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = -1 Query: 399 YSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 YS WIGGSILASL TF++MW+SK+EY E G +HRK F Sbjct: 338 YSTWIGGSILASLDTFKKMWVSKKEYEEDGSRAIHRKTF 376 >BC010090-1|AAH10090.1| 376|Homo sapiens ARP1 actin-related protein 1 homolog B, centractin beta (yeast) protein. Length = 376 Score = 64.1 bits (149), Expect = 2e-10 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = -1 Query: 399 YSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 YS WIGGSILASL TF++MW+SK+EY E G +HRK F Sbjct: 338 YSTWIGGSILASLDTFKKMWVSKKEYEEDGSRAIHRKTF 376 >BC006372-1|AAH06372.1| 376|Homo sapiens ARP1 actin-related protein 1 homolog B, centractin beta (yeast) protein. Length = 376 Score = 64.1 bits (149), Expect = 2e-10 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = -1 Query: 399 YSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 YS WIGGSILASL TF++MW+SK+EY E G +HRK F Sbjct: 338 YSTWIGGSILASLDTFKKMWVSKKEYEEDGSRAIHRKTF 376 >BC004374-1|AAH04374.1| 376|Homo sapiens ARP1 actin-related protein 1 homolog B, centractin beta (yeast) protein. Length = 376 Score = 64.1 bits (149), Expect = 2e-10 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = -1 Query: 399 YSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 YS WIGGSILASL TF++MW+SK+EY E G +HRK F Sbjct: 338 YSTWIGGSILASLDTFKKMWVSKKEYEEDGSRAIHRKTF 376 >AC017099-2|AAY24280.1| 376|Homo sapiens unknown protein. Length = 376 Score = 64.1 bits (149), Expect = 2e-10 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = -1 Query: 399 YSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 YS WIGGSILASL TF++MW+SK+EY E G +HRK F Sbjct: 338 YSTWIGGSILASLDTFKKMWVSKKEYEEDGSRAIHRKTF 376 >Z14978-1|CAA78701.1| 376|Homo sapiens actin-related protein protein. Length = 376 Score = 63.7 bits (148), Expect = 2e-10 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = -1 Query: 399 YSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 YS WIGGSILASL TF++MW+SK+EY E G +HRK F Sbjct: 338 YSTWIGGSILASLDTFKKMWVSKKEYEEDGARSIHRKTF 376 >X82206-1|CAA57690.1| 376|Homo sapiens alpha-centractin protein. Length = 376 Score = 63.7 bits (148), Expect = 2e-10 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = -1 Query: 399 YSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 YS WIGGSILASL TF++MW+SK+EY E G +HRK F Sbjct: 338 YSTWIGGSILASLDTFKKMWVSKKEYEEDGARSIHRKTF 376 >BC026016-1|AAH26016.1| 376|Homo sapiens ARP1 actin-related protein 1 homolog A, centractin alpha (yeast) protein. Length = 376 Score = 63.7 bits (148), Expect = 2e-10 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = -1 Query: 399 YSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 YS WIGGSILASL TF++MW+SK+EY E G +HRK F Sbjct: 338 YSTWIGGSILASLDTFKKMWVSKKEYEEDGARSIHRKTF 376 >BC000693-1|AAH00693.1| 376|Homo sapiens ARP1 actin-related protein 1 homolog A, centractin alpha (yeast) protein. Length = 376 Score = 63.7 bits (148), Expect = 2e-10 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = -1 Query: 399 YSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 YS WIGGSILASL TF++MW+SK+EY E G +HRK F Sbjct: 338 YSTWIGGSILASLDTFKKMWVSKKEYEEDGARSIHRKTF 376 >AL121928-12|CAC08404.1| 376|Homo sapiens ARP1 actin-related protein 1 homolog A, centractin alpha (yeast) protein. Length = 376 Score = 63.7 bits (148), Expect = 2e-10 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = -1 Query: 399 YSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 YS WIGGSILASL TF++MW+SK+EY E G +HRK F Sbjct: 338 YSTWIGGSILASLDTFKKMWVSKKEYEEDGARSIHRKTF 376 >BC045752-1|AAH45752.1| 416|Homo sapiens hypothetical protein MGC33407 protein. Length = 416 Score = 62.9 bits (146), Expect = 4e-10 Identities = 25/39 (64%), Positives = 31/39 (79%) Frame = -1 Query: 399 YSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 +SVWIGGSILASL FQ W+ +E+Y E GP IV+RKC+ Sbjct: 378 FSVWIGGSILASLRAFQSCWVLREQYEEQGPYIVYRKCY 416 >BC024028-1|AAH24028.1| 416|Homo sapiens hypothetical protein MGC33407 protein. Length = 416 Score = 62.9 bits (146), Expect = 4e-10 Identities = 25/39 (64%), Positives = 31/39 (79%) Frame = -1 Query: 399 YSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 +SVWIGGSILASL FQ W+ +E+Y E GP IV+RKC+ Sbjct: 378 FSVWIGGSILASLRAFQSCWVLREQYEEQGPYIVYRKCY 416 >BC033789-1|AAH33789.1| 415|Homo sapiens actin-like 7B protein. Length = 415 Score = 58.0 bits (134), Expect = 1e-08 Identities = 24/39 (61%), Positives = 29/39 (74%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKC 286 K SVW GGSILASL FQQ+W+SKEE+ E G ++ KC Sbjct: 377 KTSVWTGGSILASLQAFQQLWVSKEEFEERGSVAIYSKC 415 >AL359692-3|CAI40570.1| 415|Homo sapiens actin-like 7B protein. Length = 415 Score = 58.0 bits (134), Expect = 1e-08 Identities = 24/39 (61%), Positives = 29/39 (74%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKC 286 K SVW GGSILASL FQQ+W+SKEE+ E G ++ KC Sbjct: 377 KTSVWTGGSILASLQAFQQLWVSKEEFEERGSVAIYSKC 415 >AF113527-1|AAD44110.1| 415|Homo sapiens actin-like-7-beta protein. Length = 415 Score = 58.0 bits (134), Expect = 1e-08 Identities = 24/39 (61%), Positives = 29/39 (74%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKC 286 K SVW GGSILASL FQQ+W+SKEE+ E G ++ KC Sbjct: 377 KTSVWTGGSILASLQAFQQLWVSKEEFEERGSVAIYSKC 415 >AB284521-1|BAF41972.1| 415|Homo sapiens t-actin 1 protein. Length = 415 Score = 58.0 bits (134), Expect = 1e-08 Identities = 24/39 (61%), Positives = 29/39 (74%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKC 286 K SVW GGSILASL FQQ+W+SKEE+ E G ++ KC Sbjct: 377 KTSVWTGGSILASLQAFQQLWVSKEEFEERGSVAIYSKC 415 >DQ407611-1|ABD66582.1| 151|Homo sapiens beta-actin protein. Length = 151 Score = 55.2 bits (127), Expect = 8e-08 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKE 328 KYSVWIGGSILASLSTFQQMWISK+ Sbjct: 127 KYSVWIGGSILASLSTFQQMWISKQ 151 >BC014610-1|AAH14610.1| 435|Homo sapiens actin-like 7A protein. Length = 435 Score = 54.0 bits (124), Expect = 2e-07 Identities = 21/38 (55%), Positives = 28/38 (73%) Frame = -1 Query: 396 SVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 +VW GGSILASL FQ +W+ + EY E GP ++R+CF Sbjct: 398 AVWTGGSILASLQGFQPLWVHRFEYEEHGPFFLYRRCF 435 >AL359692-4|CAI40571.1| 435|Homo sapiens actin-like 7A protein. Length = 435 Score = 54.0 bits (124), Expect = 2e-07 Identities = 21/38 (55%), Positives = 28/38 (73%) Frame = -1 Query: 396 SVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 +VW GGSILASL FQ +W+ + EY E GP ++R+CF Sbjct: 398 AVWTGGSILASLQGFQPLWVHRFEYEEHGPFFLYRRCF 435 >AF113526-1|AAD44109.1| 435|Homo sapiens actin-like-7-alpha protein. Length = 435 Score = 54.0 bits (124), Expect = 2e-07 Identities = 21/38 (55%), Positives = 28/38 (73%) Frame = -1 Query: 396 SVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 +VW GGSILASL FQ +W+ + EY E GP ++R+CF Sbjct: 398 AVWTGGSILASLQGFQPLWVHRFEYEEHGPFFLYRRCF 435 >AB284520-1|BAF41971.1| 435|Homo sapiens human t-actin 2 protein. Length = 435 Score = 54.0 bits (124), Expect = 2e-07 Identities = 21/38 (55%), Positives = 28/38 (73%) Frame = -1 Query: 396 SVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 +VW GGSILASL FQ +W+ + EY E GP ++R+CF Sbjct: 398 AVWTGGSILASLQGFQPLWVHRFEYEEHGPFFLYRRCF 435 >Z74696-1|CAI42428.1| 376|Homo sapiens actin-related protein T1 (ACTRT1) protein. Length = 376 Score = 53.2 bits (122), Expect = 3e-07 Identities = 18/39 (46%), Positives = 29/39 (74%) Frame = -1 Query: 399 YSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 +S WIG SI+ S+S+F+QMW++ ++ E G +V R+CF Sbjct: 338 FSAWIGASIMTSMSSFKQMWVTSADFKEYGTSVVQRRCF 376 >BC029499-1|AAH29499.1| 376|Homo sapiens actin-related protein T2 protein. Length = 376 Score = 53.2 bits (122), Expect = 3e-07 Identities = 19/39 (48%), Positives = 29/39 (74%) Frame = -1 Query: 399 YSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 +S WIG SI+ SLS+F+QMW++ ++ E G +V R+CF Sbjct: 338 FSTWIGASIVTSLSSFKQMWVTAADFKEFGTSVVQRRCF 376 >BC014597-1|AAH14597.1| 376|Homo sapiens actin-related protein T1 protein. Length = 376 Score = 53.2 bits (122), Expect = 3e-07 Identities = 18/39 (46%), Positives = 29/39 (74%) Frame = -1 Query: 399 YSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 +S WIG SI+ S+S+F+QMW++ ++ E G +V R+CF Sbjct: 338 FSAWIGASIMTSMSSFKQMWVTSADFKEYGTSVVQRRCF 376 >AL356984-1|CAH72587.1| 377|Homo sapiens actin-related protein M2 (ARPM2) protein. Length = 377 Score = 53.2 bits (122), Expect = 3e-07 Identities = 19/39 (48%), Positives = 29/39 (74%) Frame = -1 Query: 399 YSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 +S WIG SI+ SLS+F+QMW++ ++ E G +V R+CF Sbjct: 339 FSTWIGASIVTSLSSFKQMWVTAADFKEFGTSVVQRRCF 377 >AF440740-1|AAM00433.1| 377|Homo sapiens actin-related protein T2 protein. Length = 377 Score = 53.2 bits (122), Expect = 3e-07 Identities = 19/39 (48%), Positives = 29/39 (74%) Frame = -1 Query: 399 YSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 +S WIG SI+ SLS+F+QMW++ ++ E G +V R+CF Sbjct: 339 FSTWIGASIVTSLSSFKQMWVTAADFKEFGTSVVQRRCF 377 >AF440739-1|AAM00432.1| 376|Homo sapiens actin-related protein T1 protein. Length = 376 Score = 53.2 bits (122), Expect = 3e-07 Identities = 18/39 (46%), Positives = 29/39 (74%) Frame = -1 Query: 399 YSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 +S WIG SI+ S+S+F+QMW++ ++ E G +V R+CF Sbjct: 338 FSAWIGASIMTSMSSFKQMWVTSADFKEYGTSVVQRRCF 376 >AB057364-1|BAB85862.1| 377|Homo sapiens actin-related protein hArpM2 protein. Length = 377 Score = 53.2 bits (122), Expect = 3e-07 Identities = 19/39 (48%), Positives = 29/39 (74%) Frame = -1 Query: 399 YSVWIGGSILASLSTFQQMWISKEEYNESGPGIVHRKCF 283 +S WIG SI+ SLS+F+QMW++ ++ E G +V R+CF Sbjct: 339 FSTWIGASIVTSLSSFKQMWVTAADFKEFGTSVVQRRCF 377 >BC028909-1|AAH28909.1| 366|Homo sapiens actin-like 8 protein. Length = 366 Score = 44.4 bits (100), Expect = 1e-04 Identities = 16/28 (57%), Positives = 23/28 (82%) Frame = -1 Query: 399 YSVWIGGSILASLSTFQQMWISKEEYNE 316 +SVW+G S++A LST+Q W+S+EEY E Sbjct: 335 FSVWLGASVVAHLSTYQSEWMSREEYGE 362 >AL136529-1|CAC15940.1| 366|Homo sapiens actin-like 8 protein. Length = 366 Score = 44.4 bits (100), Expect = 1e-04 Identities = 16/28 (57%), Positives = 23/28 (82%) Frame = -1 Query: 399 YSVWIGGSILASLSTFQQMWISKEEYNE 316 +SVW+G S++A LST+Q W+S+EEY E Sbjct: 335 FSVWLGASVVAHLSTYQSEWMSREEYGE 362 >AK057339-1|BAB71434.1| 366|Homo sapiens protein ( Homo sapiens cDNA FLJ32777 fis, clone TESTI2002057, highly similar to Human actin-like peptide mRNA. ). Length = 366 Score = 44.4 bits (100), Expect = 1e-04 Identities = 16/28 (57%), Positives = 23/28 (82%) Frame = -1 Query: 399 YSVWIGGSILASLSTFQQMWISKEEYNE 316 +SVW+G S++A LST+Q W+S+EEY E Sbjct: 335 FSVWLGASVVAHLSTYQSEWMSREEYGE 362 >BC044590-1|AAH44590.1| 418|Homo sapiens ARP3 actin-related protein 3 homolog (yeast) protein. Length = 418 Score = 41.5 bits (93), Expect = 0.001 Identities = 17/34 (50%), Positives = 24/34 (70%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGI 301 +Y+VW GGS+LAS F Q+ +K++Y E GP I Sbjct: 374 RYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSI 407 >AF127773-1|AAD51904.1| 418|Homo sapiens unknown protein. Length = 418 Score = 41.5 bits (93), Expect = 0.001 Identities = 17/34 (50%), Positives = 24/34 (70%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGI 301 +Y+VW GGS+LAS F Q+ +K++Y E GP I Sbjct: 374 RYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSI 407 >AF006083-1|AAB64188.1| 418|Homo sapiens Arp3 protein. Length = 418 Score = 41.5 bits (93), Expect = 0.001 Identities = 17/34 (50%), Positives = 24/34 (70%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGI 301 +Y+VW GGS+LAS F Q+ +K++Y E GP I Sbjct: 374 RYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSI 407 >AC110769-1|AAX93226.1| 418|Homo sapiens unknown protein. Length = 418 Score = 41.5 bits (93), Expect = 0.001 Identities = 17/34 (50%), Positives = 24/34 (70%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGI 301 +Y+VW GGS+LAS F Q+ +K++Y E GP I Sbjct: 374 RYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSI 407 >AB209353-1|BAD92590.1| 369|Homo sapiens ARP3 actin-related protein 3 homolog variant protein. Length = 369 Score = 41.5 bits (93), Expect = 0.001 Identities = 17/34 (50%), Positives = 24/34 (70%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGI 301 +Y+VW GGS+LAS F Q+ +K++Y E GP I Sbjct: 325 RYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSI 358 >X82208-1|CAA57692.1| 329|Homo sapiens beta-centractin protein. Length = 329 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/20 (80%), Positives = 18/20 (90%) Frame = -1 Query: 399 YSVWIGGSILASLSTFQQMW 340 YS WIGGSILASL TF++MW Sbjct: 308 YSTWIGGSILASLDTFKKMW 327 >BC008682-1|AAH08682.1| 418|Homo sapiens ARP3 actin-related protein 3 homolog B (yeast) protein. Length = 418 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/34 (50%), Positives = 24/34 (70%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGI 301 +Y+VW GGS+LAS F Q+ +K++Y E GP I Sbjct: 374 RYAVWFGGSMLASTPEFFQVCHTKKDYEEYGPSI 407 >AF023453-1|AAC98904.1| 418|Homo sapiens actin-related protein 3-beta protein. Length = 418 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/34 (50%), Positives = 24/34 (70%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGI 301 +Y+VW GGS+LAS F Q+ +K++Y E GP I Sbjct: 374 RYAVWFGGSMLASTPEFFQVCHTKKDYEEYGPSI 407 >AB209174-1|BAD92411.1| 282|Homo sapiens actin-related protein 3-beta variant protein. Length = 282 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/34 (50%), Positives = 24/34 (70%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQMWISKEEYNESGPGI 301 +Y+VW GGS+LAS F Q+ +K++Y E GP I Sbjct: 238 RYAVWFGGSMLASTPEFFQVCHTKKDYEEYGPSI 271 >AL121906-3|CAI22126.1| 245|Homo sapiens chromosome 20 open reading frame 134 protein. Length = 245 Score = 40.3 bits (90), Expect = 0.002 Identities = 15/34 (44%), Positives = 25/34 (73%) Frame = -1 Query: 396 SVWIGGSILASLSTFQQMWISKEEYNESGPGIVH 295 +VW GGS++ASL +FQ+ WI++ Y E G +++ Sbjct: 208 AVWTGGSMVASLHSFQRRWITRAMYQECGSRLLY 241 >BC032744-1|AAH32744.1| 329|Homo sapiens ACTR8 protein protein. Length = 329 Score = 33.1 bits (72), Expect = 0.36 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = -1 Query: 390 WIGGSILASLSTFQQMWISKEEYNESG 310 W GG++LA L T Q++WI + E+ G Sbjct: 291 WKGGAVLACLDTTQELWIYQREWQRFG 317 >AK026232-1|BAB15402.1| 374|Homo sapiens protein ( Homo sapiens cDNA: FLJ22579 fis, clone HSI02562. ). Length = 374 Score = 33.1 bits (72), Expect = 0.36 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = -1 Query: 390 WIGGSILASLSTFQQMWISKEEYNESG 310 W GG++LA L T Q++WI + E+ G Sbjct: 336 WKGGAVLACLDTTQELWIYQREWQRFG 362 >AK022996-1|BAB14352.1| 624|Homo sapiens protein ( Homo sapiens cDNA FLJ12934 fis, clone NT2RP2004978, weakly similar to ACTIN-LIKE PROTEIN ARP8. ). Length = 624 Score = 33.1 bits (72), Expect = 0.36 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = -1 Query: 390 WIGGSILASLSTFQQMWISKEEYNESG 310 W GG++LA L T Q++WI + E+ G Sbjct: 586 WKGGAVLACLGTTQELWIYQREWQRFG 612 >BC015107-1|AAH15107.1| 396|Homo sapiens ARP6 actin-related protein 6 homolog (yeast) protein. Length = 396 Score = 31.5 bits (68), Expect = 1.1 Identities = 10/34 (29%), Positives = 20/34 (58%) Frame = -1 Query: 390 WIGGSILASLSTFQQMWISKEEYNESGPGIVHRK 289 W GG +++ F+ M +++E+Y E+G + K Sbjct: 360 WEGGKLISENDDFEDMVVTREDYEENGHSVCEEK 393 >AK222959-1|BAD96679.1| 396|Homo sapiens ARP6 actin-related protein 6 homolog protein. Length = 396 Score = 31.5 bits (68), Expect = 1.1 Identities = 10/34 (29%), Positives = 20/34 (58%) Frame = -1 Query: 390 WIGGSILASLSTFQQMWISKEEYNESGPGIVHRK 289 W GG +++ F+ M +++E+Y E+G + K Sbjct: 360 WEGGKLISENDDFEDMVVTREDYEENGHSVCEEK 393 >AK023684-1|BAB14640.1| 288|Homo sapiens protein ( Homo sapiens cDNA FLJ13622 fis, clone PLACE1010960, weakly similar to ACTIN-LIKE PROTEIN 13E. ). Length = 288 Score = 31.5 bits (68), Expect = 1.1 Identities = 10/34 (29%), Positives = 20/34 (58%) Frame = -1 Query: 390 WIGGSILASLSTFQQMWISKEEYNESGPGIVHRK 289 W GG +++ F+ M +++E+Y E+G + K Sbjct: 252 WEGGKLISENDDFEDMVVTREDYEENGHSVCEEK 285 >AK023495-1|BAB14588.1| 396|Homo sapiens protein ( Homo sapiens cDNA FLJ13433 fis, clone PLACE1002571, weakly similar to ACTIN-LIKE PROTEIN 13E. ). Length = 396 Score = 31.5 bits (68), Expect = 1.1 Identities = 10/34 (29%), Positives = 20/34 (58%) Frame = -1 Query: 390 WIGGSILASLSTFQQMWISKEEYNESGPGIVHRK 289 W GG +++ F+ M +++E+Y E+G + K Sbjct: 360 WEGGKLISENDDFEDMVVTREDYEENGHSVCEEK 393 >AF330055-1|AAK94199.1| 430|Homo sapiens neuropeptide NPVF receptor protein. Length = 430 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = -1 Query: 333 KEEYNESGPGIVHRKCF*AARPRDPG 256 KE Y+E G++HR+ F ARP D G Sbjct: 357 KEAYSERPGGLLHRRVFVVARPSDSG 382 >AF212251-1|AAK14934.1| 396|Homo sapiens CDA12 protein. Length = 396 Score = 31.5 bits (68), Expect = 1.1 Identities = 10/34 (29%), Positives = 20/34 (58%) Frame = -1 Query: 390 WIGGSILASLSTFQQMWISKEEYNESGPGIVHRK 289 W GG +++ F+ M +++E+Y E+G + K Sbjct: 360 WEGGKLISENDDFEDMVVTREDYEENGHSVCEEK 393 >AB038229-1|BAB20762.1| 396|Homo sapiens hARPX protein. Length = 396 Score = 31.5 bits (68), Expect = 1.1 Identities = 10/34 (29%), Positives = 20/34 (58%) Frame = -1 Query: 390 WIGGSILASLSTFQQMWISKEEYNESGPGIVHRK 289 W GG +++ F+ M +++E+Y E+G + K Sbjct: 360 WEGGKLISENDDFEDMVVTREDYEENGHSVCEEK 393 >BC036253-1|AAH36253.1| 339|Homo sapiens ACTR2 protein protein. Length = 339 Score = 30.7 bits (66), Expect = 1.9 Identities = 11/38 (28%), Positives = 25/38 (65%), Gaps = 1/38 (2%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQ-MWISKEEYNESGPGIVHR 292 K+ V++GG++LA + + W++++EY E G ++ + Sbjct: 296 KHMVFLGGAVLADIMKDKDNFWMTRQEYQEKGVRVLEK 333 >BC014546-1|AAH14546.1| 394|Homo sapiens ARP2 actin-related protein 2 homolog (yeast) protein. Length = 394 Score = 30.7 bits (66), Expect = 1.9 Identities = 11/38 (28%), Positives = 25/38 (65%), Gaps = 1/38 (2%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQ-MWISKEEYNESGPGIVHR 292 K+ V++GG++LA + + W++++EY E G ++ + Sbjct: 351 KHMVFLGGAVLADIMKDKDNFWMTRQEYQEKGVRVLEK 388 >AF006082-1|AAB64187.1| 394|Homo sapiens Arp2 protein. Length = 394 Score = 30.7 bits (66), Expect = 1.9 Identities = 11/38 (28%), Positives = 25/38 (65%), Gaps = 1/38 (2%) Frame = -1 Query: 402 KYSVWIGGSILASLSTFQQ-MWISKEEYNESGPGIVHR 292 K+ V++GG++LA + + W++++EY E G ++ + Sbjct: 351 KHMVFLGGAVLADIMKDKDNFWMTRQEYQEKGVRVLEK 388 >BC131580-1|AAI31581.1| 430|Homo sapiens neuropeptide FF receptor 1 protein. Length = 430 Score = 29.9 bits (64), Expect = 3.3 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -1 Query: 333 KEEYNESGPGIVHRKCF*AARPRDPG 256 KE Y+E G++HR+ F RP D G Sbjct: 357 KEAYSERPGGLLHRRVFVVVRPSDSG 382 >AL355138-1|CAI12599.1| 428|Homo sapiens neuropeptide FF receptor 1 protein. Length = 428 Score = 29.9 bits (64), Expect = 3.3 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -1 Query: 333 KEEYNESGPGIVHRKCF*AARPRDPG 256 KE Y+E G++HR+ F RP D G Sbjct: 355 KEAYSERPGGLLHRRVFVVVRPSDSG 380 >AF268898-1|AAG41397.1| 430|Homo sapiens neuropeptide FF receptor 1 protein. Length = 430 Score = 29.9 bits (64), Expect = 3.3 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -1 Query: 333 KEEYNESGPGIVHRKCF*AARPRDPG 256 KE Y+E G++HR+ F RP D G Sbjct: 357 KEAYSERPGGLLHRRVFVVVRPSDSG 382 >AB065729-1|BAC05950.1| 441|Homo sapiens seven transmembrane helix receptor protein. Length = 441 Score = 29.9 bits (64), Expect = 3.3 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -1 Query: 333 KEEYNESGPGIVHRKCF*AARPRDPG 256 KE Y+E G++HR+ F RP D G Sbjct: 368 KEAYSERPGGLLHRRVFVVVRPSDSG 393 >AB040104-1|BAB17677.1| 430|Homo sapiens RFamide-related peptide receptor protein. Length = 430 Score = 29.9 bits (64), Expect = 3.3 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -1 Query: 333 KEEYNESGPGIVHRKCF*AARPRDPG 256 KE Y+E G++HR+ F RP D G Sbjct: 357 KEAYSERPGGLLHRRVFVVVRPSDSG 382 >BC047635-1|AAH47635.1| 404|Homo sapiens SLC39A12 protein protein. Length = 404 Score = 28.7 bits (61), Expect = 7.7 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = -1 Query: 339 ISKEEYNESGPGIVHRKCF*AARPRDPGAVWCC 241 ISKE++ + PGI+ R F A R G + C Sbjct: 328 ISKEDFKQMSPGIIQRWSFSIAVRRTTGLSYSC 360 >AF053356-5|AAC78795.1| 475|Homo sapiens actin like gene protein. Length = 475 Score = 28.7 bits (61), Expect = 7.7 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -1 Query: 402 KYSVWIGGSILASL 361 K+S WIGGSILASL Sbjct: 387 KFSPWIGGSILASL 400 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 55,149,060 Number of Sequences: 237096 Number of extensions: 977085 Number of successful extensions: 1985 Number of sequences better than 10.0: 144 Number of HSP's better than 10.0 without gapping: 1966 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1985 length of database: 76,859,062 effective HSP length: 82 effective length of database: 57,417,190 effective search space used: 2928276690 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -