BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30039X (421 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_01_0047 - 323097-323162,323287-323900,324233-324626,324718-32... 105 2e-23 01_07_0285 - 42476767-42476832,42476990-42477603,42477821-424782... 105 2e-23 12_01_0409 - 3230853-3230918,3231372-3231994,3232454-3232847,323... 103 4e-23 03_06_0585 - 34912159-34912224,34912634-34913247,34913350-349137... 103 6e-23 03_05_0926 + 28871800-28871859,28871943-28872336,28872586-288731... 102 1e-22 05_04_0450 - 21356877-21356942,21357482-21358095,21358173-213585... 102 1e-22 01_06_1455 + 37504175-37504231,37504357-37504750,37504865-375054... 102 1e-22 10_08_0597 + 19089616-19089675,19089789-19090182,19090451-190910... 101 3e-22 11_01_0403 + 3059650-3059709,3059807-3060200,3060275-3060930,306... 89 2e-18 08_01_0254 + 2078380-2078392,2078487-2078578,2079579-2079698,207... 47 5e-06 03_06_0192 + 32230953-32231030,32231130-32231485,32232250-322324... 46 1e-05 12_02_1282 + 27528159-27529148,27529549-27529614 44 4e-05 01_01_1170 - 9318332-9318461,9318551-9318613,9318694-9318744,931... 36 0.010 02_04_0473 + 23197294-23197340,23197443-23197680,23197792-231980... 33 0.071 08_01_0194 - 1603702-1603782,1603970-1604062,1604203-1604328,160... 31 0.28 08_02_0441 - 17196352-17196536,17196780-17196906,17198018-171981... 30 0.87 04_04_1515 + 34117383-34117732,34117833-34117918,34118227-341182... 29 1.1 03_06_0429 - 33863848-33864237,33864396-33864506,33864857-338649... 27 4.6 09_06_0328 + 22365308-22365415,22365743-22366018,22366166-223664... 27 8.1 04_04_1136 - 31142742-31142806,31143245-31143325,31143432-311435... 27 8.1 >05_01_0047 - 323097-323162,323287-323900,324233-324626,324718-324777 Length = 377 Score = 105 bits (251), Expect = 2e-23 Identities = 48/57 (84%), Positives = 53/57 (92%) Frame = -3 Query: 419 ALAPSSTKIKIIAPPDRKHSVRIGGSILASLSTFQQMWISKEESDESGPGIVHRKCF 249 ALAPSS KIK++APP+RK+SV IGGSILASLSTFQQMWISK+E DESGP IVHRKCF Sbjct: 321 ALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKDEYDESGPAIVHRKCF 377 >01_07_0285 - 42476767-42476832,42476990-42477603,42477821-42478214, 42478301-42478360 Length = 377 Score = 105 bits (251), Expect = 2e-23 Identities = 48/57 (84%), Positives = 53/57 (92%) Frame = -3 Query: 419 ALAPSSTKIKIIAPPDRKHSVRIGGSILASLSTFQQMWISKEESDESGPGIVHRKCF 249 ALAPSS KIK++APP+RK+SV IGGSILASLSTFQQMWISK+E DESGP IVHRKCF Sbjct: 321 ALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKDEYDESGPAIVHRKCF 377 >12_01_0409 - 3230853-3230918,3231372-3231994,3232454-3232847, 3233000-3233059 Length = 380 Score = 103 bits (248), Expect = 4e-23 Identities = 48/57 (84%), Positives = 52/57 (91%) Frame = -3 Query: 419 ALAPSSTKIKIIAPPDRKHSVRIGGSILASLSTFQQMWISKEESDESGPGIVHRKCF 249 ALAPSS KIK++APP+RK+SV IGGSILASLSTFQQMWISK E DESGP IVHRKCF Sbjct: 324 ALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKAEYDESGPAIVHRKCF 380 >03_06_0585 - 34912159-34912224,34912634-34913247,34913350-34913734, 34913824-34913883 Length = 374 Score = 103 bits (247), Expect = 6e-23 Identities = 48/57 (84%), Positives = 52/57 (91%) Frame = -3 Query: 419 ALAPSSTKIKIIAPPDRKHSVRIGGSILASLSTFQQMWISKEESDESGPGIVHRKCF 249 ALAPSS KIK++APP+RK+SV IGGSILASLSTFQQMWISK E DESGP IVHRKCF Sbjct: 318 ALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 374 >03_05_0926 + 28871800-28871859,28871943-28872336,28872586-28873199, 28873281-28873346 Length = 377 Score = 102 bits (245), Expect = 1e-22 Identities = 47/57 (82%), Positives = 52/57 (91%) Frame = -3 Query: 419 ALAPSSTKIKIIAPPDRKHSVRIGGSILASLSTFQQMWISKEESDESGPGIVHRKCF 249 ALAPSS KIK++APP+RK+SV IGGSILASLSTFQQMWI+K E DESGP IVHRKCF Sbjct: 321 ALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 377 >05_04_0450 - 21356877-21356942,21357482-21358095,21358173-21358566, 21358648-21358704 Length = 376 Score = 102 bits (244), Expect = 1e-22 Identities = 47/57 (82%), Positives = 52/57 (91%) Frame = -3 Query: 419 ALAPSSTKIKIIAPPDRKHSVRIGGSILASLSTFQQMWISKEESDESGPGIVHRKCF 249 +LAPSS K+K+IAPP+RK+SV IGGSILASLSTFQQMWISK E DESGPGIVH KCF Sbjct: 320 SLAPSSMKVKVIAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPGIVHMKCF 376 >01_06_1455 + 37504175-37504231,37504357-37504750,37504865-37505478, 37506021-37506086 Length = 376 Score = 102 bits (244), Expect = 1e-22 Identities = 47/57 (82%), Positives = 51/57 (89%) Frame = -3 Query: 419 ALAPSSTKIKIIAPPDRKHSVRIGGSILASLSTFQQMWISKEESDESGPGIVHRKCF 249 ALAP S KIK++APP+RK+SV IGGSILASLSTFQQMWISK E DESGPGIVH KCF Sbjct: 320 ALAPGSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKAEYDESGPGIVHMKCF 376 >10_08_0597 + 19089616-19089675,19089789-19090182,19090451-19091064, 19091160-19091225 Length = 377 Score = 101 bits (241), Expect = 3e-22 Identities = 46/57 (80%), Positives = 52/57 (91%) Frame = -3 Query: 419 ALAPSSTKIKIIAPPDRKHSVRIGGSILASLSTFQQMWISKEESDESGPGIVHRKCF 249 ALAPSS KIK++APP+RK+SV IGGSILASLSTFQQMWIS+ E +ESGP IVHRKCF Sbjct: 321 ALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISRAEYEESGPAIVHRKCF 377 >11_01_0403 + 3059650-3059709,3059807-3060200,3060275-3060930, 3060979-3061044 Length = 391 Score = 88.6 bits (210), Expect = 2e-18 Identities = 48/71 (67%), Positives = 52/71 (73%), Gaps = 14/71 (19%) Frame = -3 Query: 419 ALAPSSTKIKIIAPPDRKHSVRIGGSILASLSTFQ--------------QMWISKEESDE 282 ALAPSS KIK++APP+RK+SV IGGSILASLSTFQ QMWISK E DE Sbjct: 321 ALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQVNLTPTLYEVARMQMWISKGEYDE 380 Query: 281 SGPGIVHRKCF 249 SGP IVHRKCF Sbjct: 381 SGPAIVHRKCF 391 >08_01_0254 + 2078380-2078392,2078487-2078578,2079579-2079698, 2079924-2080097,2080184-2080257,2080847-2080927, 2081306-2081366,2081437-2081486,2082278-2082332, 2082599-2082676,2082757-2082810,2083703-2083756, 2083846-2083906,2084229-2084280,2085118-2085184, 2085393-2085452,2085546-2085608,2085752-2085814, 2086337-2086401,2086620-2086688,2086742-2086847 Length = 503 Score = 47.2 bits (107), Expect = 5e-06 Identities = 23/42 (54%), Positives = 32/42 (76%), Gaps = 3/42 (7%) Frame = -3 Query: 404 STKIKIIAPP---DRKHSVRIGGSILASLSTFQQMWISKEES 288 +T++K++A +R+ SV IGGSILASL +FQQMW SK +S Sbjct: 429 NTRVKVLASGNSVERRFSVWIGGSILASLGSFQQMWFSKADS 470 >03_06_0192 + 32230953-32231030,32231130-32231485,32232250-32232425, 32233857-32234038,32234260-32234443,32235192-32235259, 32235343-32235495 Length = 398 Score = 46.0 bits (104), Expect = 1e-05 Identities = 23/58 (39%), Positives = 35/58 (60%), Gaps = 1/58 (1%) Frame = -3 Query: 419 ALAPSSTKIKIIAPPD-RKHSVRIGGSILASLSTFQQMWISKEESDESGPGIVHRKCF 249 A+ PS K P + ++S +GG+ILA + Q ++K + DE+GP IVH+KCF Sbjct: 341 AICPSLVKPPEYMPENLARYSAWLGGAILAKVVFPQNQHVTKGDYDETGPSIVHKKCF 398 >12_02_1282 + 27528159-27529148,27529549-27529614 Length = 351 Score = 44.4 bits (100), Expect = 4e-05 Identities = 20/30 (66%), Positives = 22/30 (73%) Frame = -3 Query: 338 LASLSTFQQMWISKEESDESGPGIVHRKCF 249 LA S +MWI+K E DESGP IVHRKCF Sbjct: 322 LAPSSMKIKMWIAKAEYDESGPSIVHRKCF 351 >01_01_1170 - 9318332-9318461,9318551-9318613,9318694-9318744, 9318837-9318921,9319005-9319068,9319139-9319340, 9319808-9320502 Length = 429 Score = 36.3 bits (80), Expect = 0.010 Identities = 21/56 (37%), Positives = 28/56 (50%) Frame = -3 Query: 416 LAPSSTKIKIIAPPDRKHSVRIGGSILASLSTFQQMWISKEESDESGPGIVHRKCF 249 L P ++KIIA D GGS+LA F+ M I+K E +E G R+ F Sbjct: 373 LVPDDYQVKIIAQEDPILGAWRGGSLLAHRPDFESMCITKSEYEEMGSMRCRRRFF 428 >02_04_0473 + 23197294-23197340,23197443-23197680,23197792-23198016, 23198616-23198762,23198827-23198961,23199415-23199507, 23199925-23200044,23200303-23200413,23200486-23200611, 23200731-23200829,23201024-23201104 Length = 473 Score = 33.5 bits (73), Expect = 0.071 Identities = 14/44 (31%), Positives = 28/44 (63%) Frame = -3 Query: 398 KIKIIAPPDRKHSVRIGGSILASLSTFQQMWISKEESDESGPGI 267 ++ +++ P ++++V GGS+LAS + F + +K E +E G I Sbjct: 419 EVNVVSHPIQRYAVWFGGSVLASTAEFYEACHTKAEYEEYGASI 462 >08_01_0194 - 1603702-1603782,1603970-1604062,1604203-1604328, 1604403-1604513,1604989-1605108,1605665-1605757, 1606024-1606157,1606503-1606530,1606821-1607075, 1607167-1607401,1608147-1608193 Length = 440 Score = 31.5 bits (68), Expect = 0.28 Identities = 14/44 (31%), Positives = 25/44 (56%) Frame = -3 Query: 398 KIKIIAPPDRKHSVRIGGSILASLSTFQQMWISKEESDESGPGI 267 ++ ++A P + ++ GGS+ AS F + +KEE +E G I Sbjct: 386 EVNVVAHPIQSYAAWFGGSVAASNPEFYESCHTKEEYEEHGASI 429 >08_02_0441 - 17196352-17196536,17196780-17196906,17198018-17198101, 17198282-17198348,17198575-17198633,17199211-17199336, 17199406-17199474,17199545-17199653,17199692-17199760, 17199876-17199979,17200518-17200567,17200696-17200774, 17200867-17200938,17201083-17201217,17201311-17201421, 17202088-17202129 Length = 495 Score = 29.9 bits (64), Expect = 0.87 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = -3 Query: 398 KIKIIAPPDRKHSVRIGGSILASL 327 +++I PP RKH V +GG++LA + Sbjct: 367 RLRIEDPPRRKHMVYLGGAVLAGI 390 >04_04_1515 + 34117383-34117732,34117833-34117918,34118227-34118297, 34118457-34118524,34118692-34118753,34119010-34119107, 34119545-34119626,34119935-34120077,34120233-34120381, 34120461-34120594,34120714-34120832,34120926-34121014, 34121398-34121515 Length = 522 Score = 29.5 bits (63), Expect = 1.1 Identities = 12/38 (31%), Positives = 22/38 (57%) Frame = -3 Query: 404 STKIKIIAPPDRKHSVRIGGSILASLSTFQQMWISKEE 291 S I++I PP S G +++++STF + W K++ Sbjct: 430 SEGIRVIPPPFGTDSAWFGAKMISNVSTFTEAWCIKKK 467 >03_06_0429 - 33863848-33864237,33864396-33864506,33864857-33864904, 33865666-33865785 Length = 222 Score = 27.5 bits (58), Expect = 4.6 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +3 Query: 255 LAVDDAGAGLVGFLLRDPHLLEGGQGSQDGSTD 353 L +DD+ A V DP+ GG+ QDG+T+ Sbjct: 107 LKIDDSSAAEVD--ANDPYTQSGGKNKQDGNTN 137 >09_06_0328 + 22365308-22365415,22365743-22366018,22366166-22366417, 22366542-22366939,22367028-22368021,22368199-22368409, 22368515-22368749,22368874-22368996,22369190-22369310, 22369416-22369625 Length = 975 Score = 26.6 bits (56), Expect = 8.1 Identities = 17/46 (36%), Positives = 24/46 (52%) Frame = +1 Query: 226 GSRGRAA*KHLRWTMPGPDSSDSSFEIHICWKVDREARMDPPIRTE 363 GS GR + + +PG +S SS IH+ K D E + P+R E Sbjct: 570 GSDGRLSIEQSGSVVPGSLASCSSLSIHVFNKKDNEDSL--PVRLE 613 >04_04_1136 - 31142742-31142806,31143245-31143325,31143432-31143588, 31143695-31143809,31144016-31144083,31144171-31144314, 31144393-31144470,31144555-31144637,31144729-31144768, 31144993-31145067,31145202-31145314,31145839-31145878, 31145977-31146128,31146351-31146405,31146717-31146776, 31147005-31147268,31148379-31148436,31148606-31148637 Length = 559 Score = 26.6 bits (56), Expect = 8.1 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = +3 Query: 312 LLEGGQGSQDGSTDPYG 362 LL GGQG++ GS+DP G Sbjct: 202 LLAGGQGTRLGSSDPKG 218 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,848,083 Number of Sequences: 37544 Number of extensions: 211687 Number of successful extensions: 509 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 497 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 508 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 766563072 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -