BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30039X (421 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U02964-1|AAA03444.1| 376|Anopheles gambiae actin 1D protein. 104 1e-24 U02933-1|AAA56882.1| 376|Anopheles gambiae actin 1D protein. 104 1e-24 U02930-1|AAA56881.1| 376|Anopheles gambiae actin 1D protein. 104 1e-24 CR954256-1|CAJ14142.1| 376|Anopheles gambiae actin protein. 101 1e-23 Y17705-1|CAA76825.1| 124|Anopheles gambiae opsin protein. 23 3.4 AY146719-1|AAO12079.1| 159|Anopheles gambiae odorant-binding pr... 23 3.4 AF437885-1|AAL84180.1| 157|Anopheles gambiae odorant binding pr... 23 3.4 AY748840-1|AAV28188.1| 104|Anopheles gambiae cytochrome P450 pr... 23 6.0 AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcript... 23 6.0 AY341184-1|AAR13748.1| 187|Anopheles gambiae GNBP A1 protein. 22 7.9 >U02964-1|AAA03444.1| 376|Anopheles gambiae actin 1D protein. Length = 376 Score = 104 bits (250), Expect = 1e-24 Identities = 49/57 (85%), Positives = 53/57 (92%) Frame = -3 Query: 419 ALAPSSTKIKIIAPPDRKHSVRIGGSILASLSTFQQMWISKEESDESGPGIVHRKCF 249 ALAPS+ KIKIIAPP+RK+SV IGGSILASLSTFQQMWISK+E DESGP IVHRKCF Sbjct: 320 ALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376 >U02933-1|AAA56882.1| 376|Anopheles gambiae actin 1D protein. Length = 376 Score = 104 bits (250), Expect = 1e-24 Identities = 49/57 (85%), Positives = 53/57 (92%) Frame = -3 Query: 419 ALAPSSTKIKIIAPPDRKHSVRIGGSILASLSTFQQMWISKEESDESGPGIVHRKCF 249 ALAPS+ KIKIIAPP+RK+SV IGGSILASLSTFQQMWISK+E DESGP IVHRKCF Sbjct: 320 ALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376 >U02930-1|AAA56881.1| 376|Anopheles gambiae actin 1D protein. Length = 376 Score = 104 bits (250), Expect = 1e-24 Identities = 49/57 (85%), Positives = 53/57 (92%) Frame = -3 Query: 419 ALAPSSTKIKIIAPPDRKHSVRIGGSILASLSTFQQMWISKEESDESGPGIVHRKCF 249 ALAPS+ KIKIIAPP+RK+SV IGGSILASLSTFQQMWISK+E DESGP IVHRKCF Sbjct: 320 ALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376 >CR954256-1|CAJ14142.1| 376|Anopheles gambiae actin protein. Length = 376 Score = 101 bits (241), Expect = 1e-23 Identities = 47/57 (82%), Positives = 51/57 (89%) Frame = -3 Query: 419 ALAPSSTKIKIIAPPDRKHSVRIGGSILASLSTFQQMWISKEESDESGPGIVHRKCF 249 +LAPS+ KIKIIAPP+RK+SV IGGSILASLSTFQ MWISK E DE GPGIVHRKCF Sbjct: 320 SLAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQTMWISKHEYDEGGPGIVHRKCF 376 >Y17705-1|CAA76825.1| 124|Anopheles gambiae opsin protein. Length = 124 Score = 23.4 bits (48), Expect = 3.4 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = +2 Query: 179 DGCVQNSDEHNTTQHRGHAAAL 244 +GCV++ +EH G+ A+L Sbjct: 33 EGCVRSREEHARAGQEGNVASL 54 >AY146719-1|AAO12079.1| 159|Anopheles gambiae odorant-binding protein AgamOBP2 protein. Length = 159 Score = 23.4 bits (48), Expect = 3.4 Identities = 13/43 (30%), Positives = 18/43 (41%), Gaps = 1/43 (2%) Frame = +1 Query: 196 LGRAQHHTAPGSRGRAA*KHLRWTMP-GPDSSDSSFEIHICWK 321 +G+ H A +R T P G D + +F H CWK Sbjct: 105 MGKLLEHVPTEFEDIALRMGVRCTRPKGKDVCERAFWFHKCWK 147 >AF437885-1|AAL84180.1| 157|Anopheles gambiae odorant binding protein protein. Length = 157 Score = 23.4 bits (48), Expect = 3.4 Identities = 13/43 (30%), Positives = 18/43 (41%), Gaps = 1/43 (2%) Frame = +1 Query: 196 LGRAQHHTAPGSRGRAA*KHLRWTMP-GPDSSDSSFEIHICWK 321 +G+ H A +R T P G D + +F H CWK Sbjct: 105 MGKLLEHVPTEFEDIALRMGVRCTRPKGKDVCERAFWFHKCWK 147 >AY748840-1|AAV28188.1| 104|Anopheles gambiae cytochrome P450 protein. Length = 104 Score = 22.6 bits (46), Expect = 6.0 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = -2 Query: 369 EALRTDRWIHPGFPVHLPADVDLEG 295 EALR D + G P AD +L G Sbjct: 15 EALRIDTLVPSGIPHVATADTELAG 39 >AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcriptase protein. Length = 1009 Score = 22.6 bits (46), Expect = 6.0 Identities = 16/55 (29%), Positives = 23/55 (41%) Frame = -1 Query: 247 KQRGRVTPVLCGVVLVRVLNATVSTLYLVIPEN*TSNLTPSILM*FIVKFYINLI 83 + R R + C VV + V NA S +L I TP L I ++ N + Sbjct: 533 RSRNRYSGRYCAVVTLDVTNAFNSASWLAIANALQRINTPKYLYDIIGDYFRNRV 587 >AY341184-1|AAR13748.1| 187|Anopheles gambiae GNBP A1 protein. Length = 187 Score = 22.2 bits (45), Expect = 7.9 Identities = 12/39 (30%), Positives = 15/39 (38%) Frame = +3 Query: 159 ITRYNVLTVAFRTRTSTTPHSTGVTRPRCLEALAVDDAG 275 +TR T T+TT T T P C L + G Sbjct: 114 VTRTKATVAPKSTTTTTTVKPTTTTPPPCPPTLTTFNGG 152 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 402,121 Number of Sequences: 2352 Number of extensions: 7205 Number of successful extensions: 23 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 34632603 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -