BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30039X (421 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81584-6|CAB04678.1| 376|Caenorhabditis elegans Hypothetical pr... 104 2e-23 Z81584-5|CAB04675.1| 376|Caenorhabditis elegans Hypothetical pr... 104 2e-23 Z81584-4|CAB04676.1| 376|Caenorhabditis elegans Hypothetical pr... 104 2e-23 X16799-1|CAA34720.1| 376|Caenorhabditis elegans actin protein. 104 2e-23 X16797-1|CAA34718.1| 376|Caenorhabditis elegans actin protein. 104 2e-23 X16796-1|CAA34717.1| 376|Caenorhabditis elegans actin protein. 104 2e-23 U64601-7|AAK77622.1| 332|Caenorhabditis elegans Actin protein 4... 104 2e-23 U64601-6|AAT92068.1| 362|Caenorhabditis elegans Actin protein 4... 104 2e-23 U64601-5|AAB04575.1| 376|Caenorhabditis elegans Actin protein 4... 104 2e-23 Z83241-1|CAB05817.1| 375|Caenorhabditis elegans Hypothetical pr... 103 7e-23 X16798-1|CAA34719.1| 375|Caenorhabditis elegans actin protein. 99 1e-21 AC006833-3|AAF60947.2| 436|Caenorhabditis elegans Hypothetical ... 66 7e-12 AL132949-19|CAB70110.2| 374|Caenorhabditis elegans Hypothetical... 56 1e-08 Z71181-1|CAA94894.1| 395|Caenorhabditis elegans Hypothetical pr... 47 5e-06 AC024200-9|AAF36012.1| 425|Caenorhabditis elegans Arp2/3 comple... 37 0.005 AL032654-9|CAA21720.1| 404|Caenorhabditis elegans Hypothetical ... 29 1.8 Z34802-7|CAA84338.2| 828|Caenorhabditis elegans Hypothetical pr... 27 4.1 AL132853-9|CAB60444.4| 1467|Caenorhabditis elegans Hypothetical ... 26 9.5 >Z81584-6|CAB04678.1| 376|Caenorhabditis elegans Hypothetical protein T04C12.6 protein. Length = 376 Score = 104 bits (250), Expect = 2e-23 Identities = 49/57 (85%), Positives = 53/57 (92%) Frame = -3 Query: 419 ALAPSSTKIKIIAPPDRKHSVRIGGSILASLSTFQQMWISKEESDESGPGIVHRKCF 249 ALAPS+ KIKIIAPP+RK+SV IGGSILASLSTFQQMWISK+E DESGP IVHRKCF Sbjct: 320 ALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376 >Z81584-5|CAB04675.1| 376|Caenorhabditis elegans Hypothetical protein T04C12.5 protein. Length = 376 Score = 104 bits (250), Expect = 2e-23 Identities = 49/57 (85%), Positives = 53/57 (92%) Frame = -3 Query: 419 ALAPSSTKIKIIAPPDRKHSVRIGGSILASLSTFQQMWISKEESDESGPGIVHRKCF 249 ALAPS+ KIKIIAPP+RK+SV IGGSILASLSTFQQMWISK+E DESGP IVHRKCF Sbjct: 320 ALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376 >Z81584-4|CAB04676.1| 376|Caenorhabditis elegans Hypothetical protein T04C12.4 protein. Length = 376 Score = 104 bits (250), Expect = 2e-23 Identities = 49/57 (85%), Positives = 53/57 (92%) Frame = -3 Query: 419 ALAPSSTKIKIIAPPDRKHSVRIGGSILASLSTFQQMWISKEESDESGPGIVHRKCF 249 ALAPS+ KIKIIAPP+RK+SV IGGSILASLSTFQQMWISK+E DESGP IVHRKCF Sbjct: 320 ALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376 >X16799-1|CAA34720.1| 376|Caenorhabditis elegans actin protein. Length = 376 Score = 104 bits (250), Expect = 2e-23 Identities = 49/57 (85%), Positives = 53/57 (92%) Frame = -3 Query: 419 ALAPSSTKIKIIAPPDRKHSVRIGGSILASLSTFQQMWISKEESDESGPGIVHRKCF 249 ALAPS+ KIKIIAPP+RK+SV IGGSILASLSTFQQMWISK+E DESGP IVHRKCF Sbjct: 320 ALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376 >X16797-1|CAA34718.1| 376|Caenorhabditis elegans actin protein. Length = 376 Score = 104 bits (250), Expect = 2e-23 Identities = 49/57 (85%), Positives = 53/57 (92%) Frame = -3 Query: 419 ALAPSSTKIKIIAPPDRKHSVRIGGSILASLSTFQQMWISKEESDESGPGIVHRKCF 249 ALAPS+ KIKIIAPP+RK+SV IGGSILASLSTFQQMWISK+E DESGP IVHRKCF Sbjct: 320 ALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376 >X16796-1|CAA34717.1| 376|Caenorhabditis elegans actin protein. Length = 376 Score = 104 bits (250), Expect = 2e-23 Identities = 49/57 (85%), Positives = 53/57 (92%) Frame = -3 Query: 419 ALAPSSTKIKIIAPPDRKHSVRIGGSILASLSTFQQMWISKEESDESGPGIVHRKCF 249 ALAPS+ KIKIIAPP+RK+SV IGGSILASLSTFQQMWISK+E DESGP IVHRKCF Sbjct: 320 ALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376 >U64601-7|AAK77622.1| 332|Caenorhabditis elegans Actin protein 4, isoform b protein. Length = 332 Score = 104 bits (250), Expect = 2e-23 Identities = 49/57 (85%), Positives = 53/57 (92%) Frame = -3 Query: 419 ALAPSSTKIKIIAPPDRKHSVRIGGSILASLSTFQQMWISKEESDESGPGIVHRKCF 249 ALAPS+ KIKIIAPP+RK+SV IGGSILASLSTFQQMWISK+E DESGP IVHRKCF Sbjct: 276 ALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 332 >U64601-6|AAT92068.1| 362|Caenorhabditis elegans Actin protein 4, isoform c protein. Length = 362 Score = 104 bits (250), Expect = 2e-23 Identities = 49/57 (85%), Positives = 53/57 (92%) Frame = -3 Query: 419 ALAPSSTKIKIIAPPDRKHSVRIGGSILASLSTFQQMWISKEESDESGPGIVHRKCF 249 ALAPS+ KIKIIAPP+RK+SV IGGSILASLSTFQQMWISK+E DESGP IVHRKCF Sbjct: 306 ALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 362 >U64601-5|AAB04575.1| 376|Caenorhabditis elegans Actin protein 4, isoform a protein. Length = 376 Score = 104 bits (250), Expect = 2e-23 Identities = 49/57 (85%), Positives = 53/57 (92%) Frame = -3 Query: 419 ALAPSSTKIKIIAPPDRKHSVRIGGSILASLSTFQQMWISKEESDESGPGIVHRKCF 249 ALAPS+ KIKIIAPP+RK+SV IGGSILASLSTFQQMWISK+E DESGP IVHRKCF Sbjct: 320 ALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376 >Z83241-1|CAB05817.1| 375|Caenorhabditis elegans Hypothetical protein T25C8.2 protein. Length = 375 Score = 103 bits (246), Expect = 7e-23 Identities = 48/56 (85%), Positives = 52/56 (92%) Frame = -3 Query: 416 LAPSSTKIKIIAPPDRKHSVRIGGSILASLSTFQQMWISKEESDESGPGIVHRKCF 249 LAPS+ KIKIIAPP+RK+SV IGGSILASLSTFQQMWISK+E DESGP IVHRKCF Sbjct: 320 LAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375 >X16798-1|CAA34719.1| 375|Caenorhabditis elegans actin protein. Length = 375 Score = 98.7 bits (235), Expect = 1e-21 Identities = 48/57 (84%), Positives = 52/57 (91%) Frame = -3 Query: 419 ALAPSSTKIKIIAPPDRKHSVRIGGSILASLSTFQQMWISKEESDESGPGIVHRKCF 249 ALAP+ KIKIIAPP+RK+SV IGGSILASLSTFQQMWISK+E DESGP IVHRKCF Sbjct: 320 ALAPTM-KIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375 >AC006833-3|AAF60947.2| 436|Caenorhabditis elegans Hypothetical protein ZK616.4 protein. Length = 436 Score = 66.5 bits (155), Expect = 7e-12 Identities = 31/56 (55%), Positives = 39/56 (69%), Gaps = 3/56 (5%) Frame = -3 Query: 410 PSSTKIKIIAPP---DRKHSVRIGGSILASLSTFQQMWISKEESDESGPGIVHRKC 252 P + K+++ A P +RK+ IGGSIL SL TFQQMW+SK E DESG IV +KC Sbjct: 380 PPTIKLRVFAAPTQAERKYGAWIGGSILGSLGTFQQMWVSKAEYDESGKSIVEKKC 435 >AL132949-19|CAB70110.2| 374|Caenorhabditis elegans Hypothetical protein Y53F4B.22 protein. Length = 374 Score = 56.0 bits (129), Expect = 1e-08 Identities = 24/56 (42%), Positives = 38/56 (67%) Frame = -3 Query: 416 LAPSSTKIKIIAPPDRKHSVRIGGSILASLSTFQQMWISKEESDESGPGIVHRKCF 249 +AP+ KI+I A +R IGGSI+ASL TF++MW+ K+E ++ G +H++ F Sbjct: 319 IAPADGKIRISASQERNSLTWIGGSIVASLDTFRKMWLGKKEYEDMGASAMHKRFF 374 >Z71181-1|CAA94894.1| 395|Caenorhabditis elegans Hypothetical protein K07C5.1 protein. Length = 395 Score = 47.2 bits (107), Expect = 5e-06 Identities = 22/43 (51%), Positives = 30/43 (69%), Gaps = 2/43 (4%) Frame = -3 Query: 398 KIKIIAPPDRKHSVRIGGSILASL--STFQQMWISKEESDESG 276 KI+I APP RKH V +GG++LA+L Q W+SK+E +E G Sbjct: 341 KIRIEAPPSRKHMVFLGGAVLANLMKDRDQDFWVSKKEYEEGG 383 >AC024200-9|AAF36012.1| 425|Caenorhabditis elegans Arp2/3 complex component protein 1 protein. Length = 425 Score = 37.1 bits (82), Expect = 0.005 Identities = 19/50 (38%), Positives = 30/50 (60%) Frame = -3 Query: 416 LAPSSTKIKIIAPPDRKHSVRIGGSILASLSTFQQMWISKEESDESGPGI 267 L P +++I+ ++++V GGS+LAS S F Q+ +K E E GP I Sbjct: 365 LKPKPIDVQVISHKMQRYAVWFGGSMLASTSEFYQVSHTKAEYMERGPSI 414 >AL032654-9|CAA21720.1| 404|Caenorhabditis elegans Hypothetical protein Y52B11A.9 protein. Length = 404 Score = 28.7 bits (61), Expect = 1.8 Identities = 20/53 (37%), Positives = 25/53 (47%), Gaps = 1/53 (1%) Frame = -3 Query: 374 DRKHSVRIGGSILASLSTFQQMWISKEESDESGPGIVHRKC-F*AARPRDPGA 219 DRK V+ G A +S F + KE+ DE GP RK +R R P A Sbjct: 213 DRKLDVK-SGVASAKISIFDMPKVKKEDPDEPGPSQPSRKSGKKRSRSRSPAA 264 >Z34802-7|CAA84338.2| 828|Caenorhabditis elegans Hypothetical protein M88.5a protein. Length = 828 Score = 27.5 bits (58), Expect = 4.1 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = +3 Query: 321 GGQGSQDGSTDPYGVLP 371 GG + +GSTDPY V+P Sbjct: 8 GGGSTGNGSTDPYAVIP 24 >AL132853-9|CAB60444.4| 1467|Caenorhabditis elegans Hypothetical protein Y80D3A.2 protein. Length = 1467 Score = 26.2 bits (55), Expect = 9.5 Identities = 20/67 (29%), Positives = 33/67 (49%), Gaps = 3/67 (4%) Frame = +3 Query: 129 GVRLDV--QFSGITRYNV-LTVAFRTRTSTTPHSTGVTRPRCLEALAVDDAGAGLVGFLL 299 G R D+ ++ + +++V VA R+R S + V RP + + G + G L Sbjct: 555 GRRQDIRQEWENLRKHDVCFLVACRSRKSASGLKFDVRRPFSEQIEVLSVRGCDVEGMLD 614 Query: 300 RDPHLLE 320 +D HLLE Sbjct: 615 QDGHLLE 621 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,542,959 Number of Sequences: 27780 Number of extensions: 152157 Number of successful extensions: 383 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 371 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 381 length of database: 12,740,198 effective HSP length: 75 effective length of database: 10,656,698 effective search space used: 682028672 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -