BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30038X (431 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ606487-1|CAE55183.1| 203|Tribolium castaneum Giant protein pr... 23 1.2 AY600516-1|AAT11864.1| 143|Tribolium castaneum optomotor-blind-... 21 3.8 AY600515-1|AAT11863.1| 134|Tribolium castaneum optomotor-blind-... 21 3.8 EF125545-1|ABL73929.1| 274|Tribolium castaneum obstractor C1 pr... 20 8.8 >AJ606487-1|CAE55183.1| 203|Tribolium castaneum Giant protein protein. Length = 203 Score = 23.0 bits (47), Expect = 1.2 Identities = 15/43 (34%), Positives = 21/43 (48%), Gaps = 4/43 (9%) Frame = +1 Query: 274 NTSTNGANSGP----RRRMSSNALKRSRPSARFSRAEEEKRLA 390 +T+T N P +RR ++ A KRSR + R E R A Sbjct: 126 STTTQNKNDDPSYWEKRRKNNEAAKRSRDARRAKEDEIAIRCA 168 >AY600516-1|AAT11864.1| 143|Tribolium castaneum optomotor-blind-like protein protein. Length = 143 Score = 21.4 bits (43), Expect = 3.8 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +3 Query: 186 SRPSIAGEGDPEFIKR 233 SR +AG+ DPE KR Sbjct: 38 SRWMVAGKADPEMPKR 53 >AY600515-1|AAT11863.1| 134|Tribolium castaneum optomotor-blind-like protein protein. Length = 134 Score = 21.4 bits (43), Expect = 3.8 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +3 Query: 186 SRPSIAGEGDPEFIKR 233 SR +AG+ DPE KR Sbjct: 38 SRWMVAGKADPEMPKR 53 >EF125545-1|ABL73929.1| 274|Tribolium castaneum obstractor C1 protein. Length = 274 Score = 20.2 bits (40), Expect = 8.8 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = +3 Query: 165 KPAPKQESRPSIAGEGDPE 221 +PA K + RP+ A PE Sbjct: 251 QPATKSKPRPAPASRNAPE 269 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 69,687 Number of Sequences: 336 Number of extensions: 1051 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 9565283 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -