BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30034 (942 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855493-1|ABH88180.1| 127|Tribolium castaneum chemosensory pro... 31 0.013 EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopre... 24 1.5 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 23 3.4 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 23 3.4 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 23 3.4 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 23 3.4 >DQ855493-1|ABH88180.1| 127|Tribolium castaneum chemosensory protein 7 protein. Length = 127 Score = 31.1 bits (67), Expect = 0.013 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = +1 Query: 784 KERQKQQLRHKALKKGLDPEALTGKHPPKIQVASKYERRVDT 909 KE ++ +RH K+ D E L+ K+ P+ Q +YE V T Sbjct: 82 KETAEKVIRHLTQKRARDWERLSKKYDPQGQYKKRYEEHVAT 123 >EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopressin receptor protein. Length = 403 Score = 24.2 bits (50), Expect = 1.5 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +3 Query: 813 QSSQEGSRPRSAHRQAPAQNS 875 QSS+ RPRS+ + AP + + Sbjct: 232 QSSESSLRPRSSQKSAPGKRT 252 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 23.0 bits (47), Expect = 3.4 Identities = 9/11 (81%), Positives = 11/11 (100%) Frame = +1 Query: 586 KTKEQLEEEKK 618 KTK++LEEEKK Sbjct: 1068 KTKKELEEEKK 1078 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 23.0 bits (47), Expect = 3.4 Identities = 9/11 (81%), Positives = 11/11 (100%) Frame = +1 Query: 586 KTKEQLEEEKK 618 KTK++LEEEKK Sbjct: 1068 KTKKELEEEKK 1078 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 23.0 bits (47), Expect = 3.4 Identities = 9/11 (81%), Positives = 11/11 (100%) Frame = +1 Query: 586 KTKEQLEEEKK 618 KTK++LEEEKK Sbjct: 1068 KTKKELEEEKK 1078 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 23.0 bits (47), Expect = 3.4 Identities = 9/11 (81%), Positives = 11/11 (100%) Frame = +1 Query: 586 KTKEQLEEEKK 618 KTK++LEEEKK Sbjct: 1068 KTKKELEEEKK 1078 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.314 0.130 0.364 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 154,661 Number of Sequences: 336 Number of extensions: 2452 Number of successful extensions: 11 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 26478848 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (22.0 bits)
- SilkBase 1999-2023 -