BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30034 (942 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 24 1.7 DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization prot... 24 2.3 DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 23 5.3 AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 23 5.3 AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase prot... 23 5.3 DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated... 22 7.0 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 24.2 bits (50), Expect = 1.7 Identities = 10/44 (22%), Positives = 20/44 (45%) Frame = +3 Query: 804 TEAQSSQEGSRPRSAHRQAPAQNSSSVQVREACRHTILHDKKKL 935 + AQS + ++ H Q S+ +Q H++LH + + Sbjct: 905 SSAQSLLQSNQQHFPHHQIQVSTSAGLQTIRLSGHSVLHSAQSV 948 >DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization protein protein. Length = 250 Score = 23.8 bits (49), Expect = 2.3 Identities = 24/119 (20%), Positives = 50/119 (42%) Frame = +1 Query: 448 QRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNAQLERNKTKEQLEEEKKISL 627 +R E + A M D +T KKS+ ++ +LE+N+ +K+ + Sbjct: 14 ERREREAEHGYASTMPMPDDMRTVTKRPKTKKSQGSRTTHNELEKNRRAHLRNCLEKLKV 73 Query: 628 SIRIKPLTIEGLSVDKLRQKAQELWECIVKLETEKYDLEERQKRQDYDLKELKERQKQQ 804 + + P T ++ L KA+ + + + E + +E+ R+ L+ E+ Q Sbjct: 74 LVPLGPETSRHTTLG-LLTKAKRFIKSLEERERKHAVHKEQLSREQRFLRRRLEQLTNQ 131 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 22.6 bits (46), Expect = 5.3 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +1 Query: 466 EKKRQAMLQAMKDASKTGPNFTIQKKSE 549 EKKRQA L + +A + G T ++ E Sbjct: 313 EKKRQAFLDLLIEAGQNGVLLTDKEVKE 340 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 22.6 bits (46), Expect = 5.3 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -1 Query: 936 TVSFCRVGSCVDTPLVLGRYLNFGRVLA 853 T +FC G C+D L + +NF LA Sbjct: 454 TKTFCCKGYCMDLLKELSKTINFTYSLA 481 >AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase protein. Length = 693 Score = 22.6 bits (46), Expect = 5.3 Identities = 12/42 (28%), Positives = 20/42 (47%) Frame = +1 Query: 433 IEEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFG 558 I + +R++ EK +L + +AS PN + NFG Sbjct: 327 INTRGERIQLTEKNGIDVLGNIMEASILSPNQNVYGDLHNFG 368 >DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 510 Score = 22.2 bits (45), Expect = 7.0 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = -3 Query: 280 AVCAIR*CIPSTVHP 236 A C I C P TVHP Sbjct: 357 AFCNIVSCSPQTVHP 371 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.314 0.130 0.364 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 193,091 Number of Sequences: 438 Number of extensions: 2915 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 30839445 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (22.0 bits)
- SilkBase 1999-2023 -