BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30028 (929 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ211693-1|ABB16909.1| 314|Tribolium castaneum dorsocross protein. 25 0.64 AM292366-1|CAL23178.2| 379|Tribolium castaneum gustatory recept... 24 1.9 AM292329-1|CAL23141.2| 379|Tribolium castaneum gustatory recept... 24 1.9 AY920544-1|AAX62142.1| 463|Tribolium castaneum cytochrome P450 ... 23 4.5 AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory recept... 22 5.9 >DQ211693-1|ABB16909.1| 314|Tribolium castaneum dorsocross protein. Length = 314 Score = 25.4 bits (53), Expect = 0.64 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -1 Query: 902 WLKNCCSFSLVKLMQSCSKP 843 W+ SFS VKL +CS P Sbjct: 114 WMNQDISFSRVKLTNTCSPP 133 >AM292366-1|CAL23178.2| 379|Tribolium castaneum gustatory receptor candidate 45 protein. Length = 379 Score = 23.8 bits (49), Expect = 1.9 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = -1 Query: 788 LFCLVSRVSLHFLTSHLKRRSKI 720 LFC++ V LHFLT +L K+ Sbjct: 173 LFCVLYVVLLHFLTYNLSLGIKL 195 >AM292329-1|CAL23141.2| 379|Tribolium castaneum gustatory receptor candidate 8 protein. Length = 379 Score = 23.8 bits (49), Expect = 1.9 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = -1 Query: 788 LFCLVSRVSLHFLTSHLKRRSKI 720 LFC++ V LHFLT +L K+ Sbjct: 173 LFCVLYVVLLHFLTYNLSLGIKL 195 >AY920544-1|AAX62142.1| 463|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 463 Score = 22.6 bits (46), Expect = 4.5 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +1 Query: 343 NDVMDYNIVSQGKTVIP 393 N + ++IV GKTVIP Sbjct: 423 NCIAKFDIVPNGKTVIP 439 >AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory receptor candidate 38 protein. Length = 436 Score = 22.2 bits (45), Expect = 5.9 Identities = 9/30 (30%), Positives = 16/30 (53%) Frame = +1 Query: 829 IFDFNGFEQLCINFTNEKLQQFFNHHMFVL 918 + D+ FE++ T +KL FF + +L Sbjct: 159 VTDWVNFERIYYKLTKKKLSVFFGNKPVIL 188 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 198,626 Number of Sequences: 336 Number of extensions: 4070 Number of successful extensions: 16 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 26065116 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -