BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30024X (369 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC530.04 |mod5||Tea1 anchoring protein Mod5|Schizosaccharomyce... 25 2.8 SPCC736.07c |||cell polarity protein |Schizosaccharomyces pombe|... 24 8.6 >SPBC530.04 |mod5||Tea1 anchoring protein Mod5|Schizosaccharomyces pombe|chr 2|||Manual Length = 522 Score = 25.4 bits (53), Expect = 2.8 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +1 Query: 199 PSYICLTASYSVSPMRRLLEMSHTPPSASV 288 P+Y LT + VSP R S PSASV Sbjct: 420 PNYANLTPTPQVSPKRPTYSRSSPLPSASV 449 >SPCC736.07c |||cell polarity protein |Schizosaccharomyces pombe|chr 3|||Manual Length = 699 Score = 23.8 bits (49), Expect = 8.6 Identities = 10/33 (30%), Positives = 21/33 (63%) Frame = -2 Query: 296 GEHTEAEGGVCDISNKRRMGLTE*DAVKQMYDG 198 G+H++++ ISN + L++ D V+Q+ +G Sbjct: 187 GDHSDSKTYESPISNSQAASLSDSDMVQQIKNG 219 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,036,535 Number of Sequences: 5004 Number of extensions: 16738 Number of successful extensions: 29 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 29 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 2,362,478 effective HSP length: 65 effective length of database: 2,037,218 effective search space used: 116121426 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -