BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30024X (369 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_1164 - 35026345-35026954,35027853-35027939,35028120-350284... 30 0.65 04_04_0951 + 29614196-29615275 27 4.6 04_03_0554 - 17075142-17075159,17075788-17076591,17076619-170767... 27 6.1 12_01_0296 + 2240376-2240580,2241556-2241764,2241847-2241975,224... 26 8.1 09_02_0384 - 8294914-8297817 26 8.1 >01_06_1164 - 35026345-35026954,35027853-35027939,35028120-35028493, 35037372-35038586,35038659-35039316,35039331-35041012 Length = 1541 Score = 29.9 bits (64), Expect = 0.65 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = +1 Query: 208 ICLTASYSVSPMRRLLEMSHTPPSASVCSPRVPRTCR 318 +CL+ S SP + TPP+ S SP PR R Sbjct: 1267 VCLSIMASASPSASPPQPDETPPADSAVSPPPPRAAR 1303 >04_04_0951 + 29614196-29615275 Length = 359 Score = 27.1 bits (57), Expect = 4.6 Identities = 18/48 (37%), Positives = 28/48 (58%) Frame = +1 Query: 175 SILMSSAMPSYICLTASYSVSPMRRLLEMSHTPPSASVCSPRVPRTCR 318 S+L+ +A+ +++ L AS S+ + RLL S PP P +PRT R Sbjct: 29 SLLIIAALLAFVLL-ASVSIHLLLRLLSRSSPPPPP---PPPLPRTRR 72 >04_03_0554 - 17075142-17075159,17075788-17076591,17076619-17076719, 17077095-17077751,17077827-17078768,17078837-17078896, 17079131-17079763,17079886-17079942,17080177-17080702 Length = 1265 Score = 26.6 bits (56), Expect = 6.1 Identities = 21/69 (30%), Positives = 27/69 (39%) Frame = +1 Query: 115 ASAER*INTQAARGGAYRDFSILMSSAMPSYICLTASYSVSPMRRLLEMSHTPPSASVCS 294 A E+ I +A R +SI M S P+YI L S V ++H A V Sbjct: 306 AKIEQVIANRALRRNTPSKYSIAMES--PTYIALDTSPQVPTRLHRKHIAHDERQALVSR 363 Query: 295 PRVPRTCRW 321 T RW Sbjct: 364 QNESFTIRW 372 >12_01_0296 + 2240376-2240580,2241556-2241764,2241847-2241975, 2242271-2242417,2243045-2243108,2243208-2243311, 2243373-2243411 Length = 298 Score = 26.2 bits (55), Expect = 8.1 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = -3 Query: 130 IVPRRPGTSQRAAPPPLLL 74 + PRR +++A+PPP LL Sbjct: 37 VAPRRENATKKASPPPSLL 55 >09_02_0384 - 8294914-8297817 Length = 967 Score = 26.2 bits (55), Expect = 8.1 Identities = 9/28 (32%), Positives = 18/28 (64%) Frame = +1 Query: 247 RLLEMSHTPPSASVCSPRVPRTCRWYLD 330 R+L+++H P S+C+ ++ C Y+D Sbjct: 832 RILQLNHLPSLESICTFKLVCPCLEYID 859 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,905,844 Number of Sequences: 37544 Number of extensions: 143650 Number of successful extensions: 467 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 454 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 467 length of database: 14,793,348 effective HSP length: 74 effective length of database: 12,015,092 effective search space used: 576724416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -