BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30022 (783 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_02_0054 - 6398829-6399047,6399470-6399676,6399858-6400557,640... 29 4.2 04_03_0376 + 15105874-15106230,15109207-15111573 28 7.3 10_01_0145 - 1708597-1708824,1710225-1710468,1711217-1711263,171... 28 9.6 >02_02_0054 - 6398829-6399047,6399470-6399676,6399858-6400557, 6400927-6401120 Length = 439 Score = 29.1 bits (62), Expect = 4.2 Identities = 11/46 (23%), Positives = 25/46 (54%), Gaps = 3/46 (6%) Frame = -3 Query: 619 RHAEWSGPCLGPKPAD---ECKRDFSDEVLKAGQTVIGLQAGSNKG 491 +++++ GPCL P D C++D++ + + + +G G+ G Sbjct: 79 KNSKYKGPCLATNPIDRCWRCRKDWATDRKRLARCAMGFGRGATGG 124 >04_03_0376 + 15105874-15106230,15109207-15111573 Length = 907 Score = 28.3 bits (60), Expect = 7.3 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = -3 Query: 763 GEHHKLPVCKSKHTVYPTSMCSKP*IYGRKKDIAQVVSTL 644 G+H + +KHT PT+ + GR KD +++S L Sbjct: 165 GDHRRYVGVTAKHTSKPTAAYLPRKVIGRDKDREEIISML 204 >10_01_0145 - 1708597-1708824,1710225-1710468,1711217-1711263, 1711767-1711857,1712982-1713094,1713387-1713462, 1713501-1713560,1713759-1713835,1714105-1714672, 1715332-1715509,1715632-1715774,1717255-1717424, 1717588-1717822,1718565-1718779 Length = 814 Score = 27.9 bits (59), Expect = 9.6 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = -3 Query: 157 HSINGWLRYFYLFIKLSSA*YEFVHKLS 74 H + GWL YF + + L SA + F+ +L+ Sbjct: 655 HVLRGWLVYFLVLVLLFSAAFMFLTRLT 682 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,217,497 Number of Sequences: 37544 Number of extensions: 426001 Number of successful extensions: 910 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 892 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 910 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2103658836 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -