BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30020 (628 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC83.07 |jmj3||Lid2 complex subunit Jmj3|Schizosaccharomyces p... 29 0.73 SPCC23B6.03c |tel1||ATM checkpoint kinase|Schizosaccharomyces po... 27 2.9 SPBCPT2R1.03 |||hypothetical protein|Schizosaccharomyces pombe|c... 27 2.9 SPBC530.04 |mod5||Tea1 anchoring protein Mod5|Schizosaccharomyce... 27 2.9 SPCC645.10 |||ATP|Schizosaccharomyces pombe|chr 3|||Manual 26 5.1 SPAC823.09c |||L-asparaginase |Schizosaccharomyces pombe|chr 1||... 25 9.0 SPBC28F2.12 |rpb1||DNA-directed RNA polymerase II large subunit|... 25 9.0 >SPBC83.07 |jmj3||Lid2 complex subunit Jmj3|Schizosaccharomyces pombe|chr 2|||Manual Length = 752 Score = 28.7 bits (61), Expect = 0.73 Identities = 17/54 (31%), Positives = 26/54 (48%) Frame = -1 Query: 598 WPTGRGIYHNENKTFLVWCNEEDHLRIISMQMGGDLQQVYKRLVSAVNEIEKKI 437 WP ++ + KT L W E L + + +GG Q Y + SA +E KK+ Sbjct: 195 WPNVGHLFAGKWKTTLPWRVESPELHAVQVHLGGSSLQWYV-IPSAHSESFKKL 247 >SPCC23B6.03c |tel1||ATM checkpoint kinase|Schizosaccharomyces pombe|chr 3|||Manual Length = 2812 Score = 26.6 bits (56), Expect = 2.9 Identities = 11/27 (40%), Positives = 19/27 (70%) Frame = -1 Query: 496 DLQQVYKRLVSAVNEIEKKIPFSHHDR 416 D+QQ+ + +V+A N E+K+ +HH R Sbjct: 2198 DIQQLERSIVNASNMKEEKMLKNHHSR 2224 >SPBCPT2R1.03 |||hypothetical protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 129 Score = 26.6 bits (56), Expect = 2.9 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = -1 Query: 229 NKRRMGLTEYDAVKEMYDGIAELIKIE 149 N R + YDAVK+ YD ++ I+ Sbjct: 50 NNRNLAFKAYDAVKQKYDSSIKVFNIQ 76 >SPBC530.04 |mod5||Tea1 anchoring protein Mod5|Schizosaccharomyces pombe|chr 2|||Manual Length = 522 Score = 26.6 bits (56), Expect = 2.9 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +3 Query: 174 PSYISLTASYSVSPMRRLLEMSYTPPSASV 263 P+Y +LT + VSP R S PSASV Sbjct: 420 PNYANLTPTPQVSPKRPTYSRSSPLPSASV 449 >SPCC645.10 |||ATP|Schizosaccharomyces pombe|chr 3|||Manual Length = 484 Score = 25.8 bits (54), Expect = 5.1 Identities = 11/37 (29%), Positives = 22/37 (59%) Frame = +3 Query: 390 VGQNVRKPSRSWCENGIFFSISLTALTSLLYTCCRSP 500 +G +R+ ++SW + LTS++Y+CC++P Sbjct: 376 IGSLIRQLNKSW---------EVVFLTSVIYSCCKTP 403 >SPAC823.09c |||L-asparaginase |Schizosaccharomyces pombe|chr 1|||Manual Length = 285 Score = 25.0 bits (52), Expect = 9.0 Identities = 13/47 (27%), Positives = 21/47 (44%), Gaps = 1/47 (2%) Frame = +3 Query: 390 VGQNVRKPSRSWCENGIFFSISLTALTSLLYTCCRSP-PICIEMMRR 527 VG N+ + CE G+ S S + CCR P C+ ++ + Sbjct: 65 VGSNLNIDGKVECEAGVMDSESGLTASVACCNCCRHPSEACLYILNK 111 >SPBC28F2.12 |rpb1||DNA-directed RNA polymerase II large subunit|Schizosaccharomyces pombe|chr 2|||Manual Length = 1752 Score = 25.0 bits (52), Expect = 9.0 Identities = 15/36 (41%), Positives = 17/36 (47%) Frame = +3 Query: 174 PSYISLTASYSVSPMRRLLEMSYTPPSASVCSPRVP 281 PSY + YS SP SY+P S S SP P Sbjct: 1556 PSYSPSSPGYSTSPAYMPSSPSYSPTSPSY-SPTSP 1590 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,801,270 Number of Sequences: 5004 Number of extensions: 29024 Number of successful extensions: 91 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 91 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 91 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 277683324 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -