BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30019 (755 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U56963-1|AAB38120.1| 161|Caenorhabditis elegans Hypothetical pr... 29 3.6 Z70208-8|CAA94143.1| 196|Caenorhabditis elegans Hypothetical pr... 28 6.2 >U56963-1|AAB38120.1| 161|Caenorhabditis elegans Hypothetical protein T13A10.2 protein. Length = 161 Score = 29.1 bits (62), Expect = 3.6 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +1 Query: 100 CSC*SHVTCGRCSQQNSTTTYGT*KLPEC 186 CSC H CG C ++ S+ G K PEC Sbjct: 115 CSC-LHTYCGACIREISSRHNGEMKCPEC 142 >Z70208-8|CAA94143.1| 196|Caenorhabditis elegans Hypothetical protein F54B11.8 protein. Length = 196 Score = 28.3 bits (60), Expect = 6.2 Identities = 13/52 (25%), Positives = 25/52 (48%) Frame = +2 Query: 500 FRNFDTFDIKTKLSTRRSKIFDHLSPDD*YTIYTKSLMYSIVRCENSSRLRY 655 ++NFD+F I + R++ ++ D T+Y+ V CE + R+ Sbjct: 36 WKNFDSFKIAILNAAARARATGNIRYDSRMTVYSHPATLQCVDCEEGVKKRF 87 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,353,019 Number of Sequences: 27780 Number of extensions: 292914 Number of successful extensions: 570 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 552 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 570 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1798543458 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -