BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30018 (894 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_01_0217 - 1712979-1713794 31 1.6 09_02_0295 - 7039870-7040634 29 3.8 01_06_1040 + 34026545-34026772,34027109-34027303 29 3.8 10_08_0814 - 20779400-20779487,20779780-20780030,20780528-207808... 29 6.6 04_01_0508 + 6647812-6647820,6647864-6648226,6649351-6650673,665... 29 6.6 06_03_1000 - 26778993-26779478 28 8.7 04_01_0240 + 3137859-3138461 28 8.7 >03_01_0217 - 1712979-1713794 Length = 271 Score = 30.7 bits (66), Expect = 1.6 Identities = 15/42 (35%), Positives = 17/42 (40%), Gaps = 1/42 (2%) Frame = -1 Query: 519 CTWPAEEHR-CSAASRRPDCSTARCTSWTRSPDGRSTAGLGC 397 C+ PA+ R C R C T W PDG ST C Sbjct: 172 CSRPAKRRRKCGEEKRCGHCQTTETPQWRVGPDGPSTLCNAC 213 >09_02_0295 - 7039870-7040634 Length = 254 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/43 (37%), Positives = 20/43 (46%) Frame = +3 Query: 426 LDYVSMMCNEQCYSLAVEKLLNIDVPLRAKYIRTLFAEITRLL 554 L Y+S +C CY A DV +RA+Y R F R L Sbjct: 167 LVYISGLCVVYCYMKASNLFSRFDVHVRARYNRLGFVAFCRSL 209 >01_06_1040 + 34026545-34026772,34027109-34027303 Length = 140 Score = 29.5 bits (63), Expect = 3.8 Identities = 17/37 (45%), Positives = 21/37 (56%) Frame = -2 Query: 884 HTAEAVVERVLRSDHADVLGPLHPDPVGGEHVLHLVD 774 H A E + SD VLG + +PVG E+ LHLVD Sbjct: 29 HRAGGEGEEKMSSDGGPVLGGV--EPVGNENDLHLVD 63 >10_08_0814 - 20779400-20779487,20779780-20780030,20780528-20780812, 20781563-20782008,20782095-20782485 Length = 486 Score = 28.7 bits (61), Expect = 6.6 Identities = 21/68 (30%), Positives = 34/68 (50%), Gaps = 3/68 (4%) Frame = +3 Query: 519 IRTLFAEITRLLNHIMAVG---THALDVGALTPFFWLFEEREKMMEFYERVSGARMHAAY 689 +RTL +++TRLL H+ V H LD +L ++ + + +S A ++ Sbjct: 263 VRTLKSDLTRLLAHVQKVRDEIEHLLDDNEDMAHLYLTRKQLQNQQVEALISSAASNS-- 320 Query: 690 IRPGGVSL 713 I PGG SL Sbjct: 321 IVPGGTSL 328 >04_01_0508 + 6647812-6647820,6647864-6648226,6649351-6650673, 6653569-6653766,6654485-6654568,6655175-6655920, 6656480-6657341 Length = 1194 Score = 28.7 bits (61), Expect = 6.6 Identities = 23/87 (26%), Positives = 37/87 (42%), Gaps = 2/87 (2%) Frame = +3 Query: 231 EKKVRNMILNFGPQHPAAHGVLRLVLELDGETVRAADPHIGLLHRGTEKLIEYKTYTQAL 410 E+ V NM + H AHG +RL +E++ +R + ++ R + YK Sbjct: 1005 EQHVSNMCKSCS-NHARAHGQVRLAMEMEKMNIRLGKEMVTMICRQIIVPVYYKNLMARS 1063 Query: 411 PYFDRL-DYVSMMCN-EQCYSLAVEKL 485 L D S N Y+L +EK+ Sbjct: 1064 AMLTCLTDSESQRANGNALYALTIEKM 1090 >06_03_1000 - 26778993-26779478 Length = 161 Score = 28.3 bits (60), Expect = 8.7 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = -1 Query: 330 GLSLRPVPVRDAAPRERLDAGARSSGSCC 244 G +LRP V APR+ AG R + CC Sbjct: 83 GSALRPATVCPPAPRKPRPAGKRMTKRCC 111 >04_01_0240 + 3137859-3138461 Length = 200 Score = 28.3 bits (60), Expect = 8.7 Identities = 21/60 (35%), Positives = 25/60 (41%) Frame = -3 Query: 199 GFNDLVDSSGYMTGPSNCFTKSGSGNQRCPSLWEFTL*TAGMFFNKTDFWPKLGDFRNKT 20 GF DL SS T S C S N LW+ T F K F L D++NK+ Sbjct: 63 GFVDLTCSSS-KTDFSKCKPGQMSYNHSSVPLWDRTTNELASFATKFTFKIVLSDYKNKS 121 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,832,245 Number of Sequences: 37544 Number of extensions: 547504 Number of successful extensions: 1607 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1540 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1606 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2518669100 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -