Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= epV30012X
         (545 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY217747-1|AAP45005.1|  246|Apis mellifera short-chain dehydroge...    21   6.2  

>AY217747-1|AAP45005.1|  246|Apis mellifera short-chain
           dehydrogenase/reductase protein.
          Length = 246

 Score = 21.4 bits (43), Expect = 6.2
 Identities = 9/33 (27%), Positives = 18/33 (54%)
 Frame = +1

Query: 373 KQKNIKHNGNISLEDVIGIAKIMRNRSMARYLS 471
           K+K I +   +++ D  G+  +  NR+   YL+
Sbjct: 131 KKKGINNGIIVNINDASGLNLLPMNRNRPAYLA 163


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 170,051
Number of Sequences: 438
Number of extensions: 3863
Number of successful extensions: 3
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 146,343
effective HSP length: 54
effective length of database: 122,691
effective search space used: 15581757
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)