BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30003 (674 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 27 0.19 DQ659251-1|ABG47449.1| 366|Tribolium castaneum chitinase 11 pro... 22 5.3 AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 prot... 21 7.0 AF230312-1|AAF64146.1| 253|Tribolium castaneum labial protein p... 21 7.0 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 21 9.2 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 26.6 bits (56), Expect = 0.19 Identities = 16/57 (28%), Positives = 22/57 (38%) Frame = -3 Query: 642 SRTRSVWTSSPTN*KRSVFSPRTLTENPTRFRENWPSLKTNSKSPKTVSSLVTLRSQ 472 S T S W ++ T + + P T + NWP+ T P V V SQ Sbjct: 1045 STTTSPWWTTTTTRRTTTTRPTTTSTTTRPTTTNWPTQGTTIPPPAVVMPEVDKPSQ 1101 >DQ659251-1|ABG47449.1| 366|Tribolium castaneum chitinase 11 protein. Length = 366 Score = 21.8 bits (44), Expect = 5.3 Identities = 7/28 (25%), Positives = 13/28 (46%) Frame = -3 Query: 207 SWLVSKLSHSTYRPHTYSNRTCTHTYAA 124 SW + +++P + CTH + A Sbjct: 32 SWAGYRNGEGSFKPQNINANLCTHVHYA 59 >AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 protein. Length = 377 Score = 21.4 bits (43), Expect = 7.0 Identities = 7/24 (29%), Positives = 9/24 (37%) Frame = -3 Query: 207 SWLVSKLSHSTYRPHTYSNRTCTH 136 SW + + Y P CTH Sbjct: 32 SWAIYRPDKGEYHPKNIDPNICTH 55 >AF230312-1|AAF64146.1| 253|Tribolium castaneum labial protein protein. Length = 253 Score = 21.4 bits (43), Expect = 7.0 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +3 Query: 444 PTTFNSSSSSEILASPD 494 P F ++SSS L SPD Sbjct: 216 PAEFPTTSSSSALESPD 232 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 21.0 bits (42), Expect = 9.2 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +3 Query: 408 FSSDTSRDLRELPTTFNS 461 F D RDL E+ +FNS Sbjct: 86 FQGDIHRDLTEVYFSFNS 103 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 115,046 Number of Sequences: 336 Number of extensions: 1976 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17593745 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -