BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30002 (746 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BX537437-1|CAD97679.1| 1137|Homo sapiens hypothetical protein pr... 30 7.7 BX537436-1|CAD97678.1| 974|Homo sapiens hypothetical protein pr... 30 7.7 BC150186-1|AAI50187.1| 601|Homo sapiens CACNA2D4 protein protein. 30 7.7 AF516695-1|AAN06672.1| 1120|Homo sapiens voltage-gated calcium c... 30 7.7 >BX537437-1|CAD97679.1| 1137|Homo sapiens hypothetical protein protein. Length = 1137 Score = 30.3 bits (65), Expect = 7.7 Identities = 17/55 (30%), Positives = 29/55 (52%) Frame = +3 Query: 18 KIERRDGTVISLKKSEDIENLARLVLGGLEIVGDDAKVIHLTNLMKKMLSYGQYN 182 KIE DG + K SED+EN+ R + ++ + + A+ L + + L + YN Sbjct: 113 KIEEVDGLELVRKFSEDMENMLRRKVEAVQNLVEAAEEADLNHEFNESLVFDYYN 167 >BX537436-1|CAD97678.1| 974|Homo sapiens hypothetical protein protein. Length = 974 Score = 30.3 bits (65), Expect = 7.7 Identities = 17/55 (30%), Positives = 29/55 (52%) Frame = +3 Query: 18 KIERRDGTVISLKKSEDIENLARLVLGGLEIVGDDAKVIHLTNLMKKMLSYGQYN 182 KIE DG + K SED+EN+ R + ++ + + A+ L + + L + YN Sbjct: 113 KIEEVDGLELVRKFSEDMENMLRRKVEAVQNLVEAAEEADLNHEFNESLVFDYYN 167 >BC150186-1|AAI50187.1| 601|Homo sapiens CACNA2D4 protein protein. Length = 601 Score = 30.3 bits (65), Expect = 7.7 Identities = 17/55 (30%), Positives = 29/55 (52%) Frame = +3 Query: 18 KIERRDGTVISLKKSEDIENLARLVLGGLEIVGDDAKVIHLTNLMKKMLSYGQYN 182 KIE DG + K SED+EN+ R + ++ + + A+ L + + L + YN Sbjct: 113 KIEEVDGLELVRKFSEDMENMLRRKVEAVQNLVEAAEEADLNHEFNESLVFDYYN 167 >AF516695-1|AAN06672.1| 1120|Homo sapiens voltage-gated calcium channel alpha(2)delta-4 subunit protein. Length = 1120 Score = 30.3 bits (65), Expect = 7.7 Identities = 17/55 (30%), Positives = 29/55 (52%) Frame = +3 Query: 18 KIERRDGTVISLKKSEDIENLARLVLGGLEIVGDDAKVIHLTNLMKKMLSYGQYN 182 KIE DG + K SED+EN+ R + ++ + + A+ L + + L + YN Sbjct: 96 KIEEVDGLELVRKFSEDMENMLRRKVEAVQNLVEAAEEADLNHEFNESLVFDYYN 150 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 108,186,643 Number of Sequences: 237096 Number of extensions: 2324145 Number of successful extensions: 7838 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7329 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7833 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8959138240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -