BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= e96h0983
(414 letters)
Database: bee
438 sequences; 146,343 total letters
Searching......................................................done
Score E
Sequences producing significant alignments: (bits) Value
DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 26 0.19
AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 20 9.6
>DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated
ion channel subunit protein.
Length = 469
Score = 25.8 bits (54), Expect = 0.19
Identities = 14/59 (23%), Positives = 24/59 (40%), Gaps = 3/59 (5%)
Frame = +1
Query: 10 IIDAVNIDDVHPLVIAGSLNWTNQALCGNWEN---VLVTSQADLVNQFKTEFEKLWLQF 177
++D V D P+++A L+ T L W N + T+ F F + + F
Sbjct: 167 VLDMVLYWDQEPIILADELHLTEYKLVEKWVNSSEIFYTTSQQYYGHFAGNFSSISITF 225
>AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine
beta-synthase protein.
Length = 504
Score = 20.2 bits (40), Expect = 9.6
Identities = 6/10 (60%), Positives = 9/10 (90%)
Frame = +1
Query: 382 NYLTKFIKKF 411
NYLTKF+ ++
Sbjct: 338 NYLTKFVSEY 347
Database: bee
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 146,343
Number of sequences in database: 438
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 96,292
Number of Sequences: 438
Number of extensions: 1588
Number of successful extensions: 2
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of database: 146,343
effective HSP length: 52
effective length of database: 123,567
effective search space used: 10503195
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)
- SilkBase 1999-2023 -