SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= e96h0983
         (414 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ667195-1|ABG75747.1|  469|Apis mellifera cys-loop ligand-gated...    26   0.19 
AB244761-1|BAE66603.1|  504|Apis mellifera cystathionine beta-sy...    20   9.6  

>DQ667195-1|ABG75747.1|  469|Apis mellifera cys-loop ligand-gated
           ion channel subunit protein.
          Length = 469

 Score = 25.8 bits (54), Expect = 0.19
 Identities = 14/59 (23%), Positives = 24/59 (40%), Gaps = 3/59 (5%)
 Frame = +1

Query: 10  IIDAVNIDDVHPLVIAGSLNWTNQALCGNWEN---VLVTSQADLVNQFKTEFEKLWLQF 177
           ++D V   D  P+++A  L+ T   L   W N   +  T+       F   F  + + F
Sbjct: 167 VLDMVLYWDQEPIILADELHLTEYKLVEKWVNSSEIFYTTSQQYYGHFAGNFSSISITF 225


>AB244761-1|BAE66603.1|  504|Apis mellifera cystathionine
           beta-synthase protein.
          Length = 504

 Score = 20.2 bits (40), Expect = 9.6
 Identities = 6/10 (60%), Positives = 9/10 (90%)
 Frame = +1

Query: 382 NYLTKFIKKF 411
           NYLTKF+ ++
Sbjct: 338 NYLTKFVSEY 347


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 96,292
Number of Sequences: 438
Number of extensions: 1588
Number of successful extensions: 2
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of database: 146,343
effective HSP length: 52
effective length of database: 123,567
effective search space used: 10503195
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)

- SilkBase 1999-2023 -