SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= e96h0970
         (375 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X72577-1|CAA51169.1|  283|Apis mellifera Apidaecin precursor pro...    22   2.1  
AY569720-1|AAS86673.1|  406|Apis mellifera complementary sex det...    21   4.8  
AY569703-1|AAS86656.1|  396|Apis mellifera complementary sex det...    21   4.8  
AY569701-1|AAS86654.1|  407|Apis mellifera complementary sex det...    21   4.8  
AY569700-1|AAS86653.1|  407|Apis mellifera complementary sex det...    21   4.8  
AY569699-1|AAS86652.1|  396|Apis mellifera complementary sex det...    21   4.8  
AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul...    21   4.8  
AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A...    21   4.8  
X72575-1|CAA51167.1|  168|Apis mellifera Apidaecin precursor pro...    21   6.3  
DQ667193-1|ABG75745.1|  510|Apis mellifera cys-loop ligand-gated...    21   6.3  
AF442148-1|AAL35349.1|  199|Apis mellifera apidaecin precursor p...    21   6.3  
AF084556-1|AAC71015.1|  652|Apis mellifera pipsqueak protein.          21   6.3  
AY569721-1|AAS86674.1|  400|Apis mellifera complementary sex det...    20   8.3  
AY569719-1|AAS86672.1|  401|Apis mellifera feminizer protein.          20   8.3  
AY569718-1|AAS86671.1|  401|Apis mellifera feminizer protein.          20   8.3  
AY569717-1|AAS86670.1|  397|Apis mellifera complementary sex det...    20   8.3  
AY569716-1|AAS86669.1|  406|Apis mellifera complementary sex det...    20   8.3  
AY569715-1|AAS86668.1|  401|Apis mellifera feminizer protein.          20   8.3  
AY569714-1|AAS86667.1|  401|Apis mellifera feminizer protein.          20   8.3  
AY569713-1|AAS86666.1|  401|Apis mellifera feminizer protein.          20   8.3  
AY569712-1|AAS86665.1|  408|Apis mellifera complementary sex det...    20   8.3  
AY569711-1|AAS86664.1|  401|Apis mellifera feminizer protein.          20   8.3  
AY569710-1|AAS86663.1|  408|Apis mellifera complementary sex det...    20   8.3  
AY569709-1|AAS86662.1|  408|Apis mellifera complementary sex det...    20   8.3  
AY569708-1|AAS86661.1|  408|Apis mellifera complementary sex det...    20   8.3  
AY569707-1|AAS86660.1|  408|Apis mellifera complementary sex det...    20   8.3  
AY569706-1|AAS86659.1|  397|Apis mellifera complementary sex det...    20   8.3  
AY569705-1|AAS86658.1|  419|Apis mellifera complementary sex det...    20   8.3  
AY569704-1|AAS86657.1|  426|Apis mellifera complementary sex det...    20   8.3  
AY569702-1|AAS86655.1|  400|Apis mellifera feminizer protein.          20   8.3  
AY569698-1|AAS86651.1|  407|Apis mellifera complementary sex det...    20   8.3  
AY569697-1|AAS86650.1|  413|Apis mellifera complementary sex det...    20   8.3  
AY569696-1|AAS86649.1|  414|Apis mellifera complementary sex det...    20   8.3  
AY569695-1|AAS86648.1|  414|Apis mellifera complementary sex det...    20   8.3  
AY569694-1|AAS86647.1|  400|Apis mellifera complementary sex det...    20   8.3  
AY352277-1|AAQ67418.1|  418|Apis mellifera complementary sex det...    20   8.3  
AY352276-1|AAQ67417.1|  385|Apis mellifera complementary sex det...    20   8.3  
AY350618-1|AAQ57660.1|  425|Apis mellifera complementary sex det...    20   8.3  
AY350617-1|AAQ57659.1|  428|Apis mellifera complementary sex det...    20   8.3  
AY350616-1|AAQ57658.1|  401|Apis mellifera complementary sex det...    20   8.3  
AY350615-1|AAQ57657.1|  410|Apis mellifera complementary sex det...    20   8.3  
AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.             20   8.3  

>X72577-1|CAA51169.1|  283|Apis mellifera Apidaecin precursor
           protein.
          Length = 283

 Score = 22.2 bits (45), Expect = 2.1
 Identities = 9/14 (64%), Positives = 10/14 (71%)
 Frame = -1

Query: 111 PAPRLRSTLKPKAK 70
           P PRLR   KP+AK
Sbjct: 251 PHPRLRREAKPEAK 264



 Score = 20.6 bits (41), Expect = 6.3
 Identities = 9/20 (45%), Positives = 12/20 (60%)
 Frame = -1

Query: 129 ISLKEDPAPRLRSTLKPKAK 70
           IS    P PRLR   +P+A+
Sbjct: 105 ISQPRPPHPRLRREAEPEAE 124



 Score = 20.6 bits (41), Expect = 6.3
 Identities = 9/20 (45%), Positives = 12/20 (60%)
 Frame = -1

Query: 129 ISLKEDPAPRLRSTLKPKAK 70
           IS    P PRLR   +P+A+
Sbjct: 161 ISQPRPPHPRLRREAEPEAE 180


>AY569720-1|AAS86673.1|  406|Apis mellifera complementary sex
           determiner protein.
          Length = 406

 Score = 21.0 bits (42), Expect = 4.8
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +2

Query: 206 GSKPLFENISVK 241
           GSKPLFE   +K
Sbjct: 169 GSKPLFEREEIK 180


>AY569703-1|AAS86656.1|  396|Apis mellifera complementary sex
           determiner protein.
          Length = 396

 Score = 21.0 bits (42), Expect = 4.8
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +2

Query: 206 GSKPLFENISVK 241
           GSKPLFE   +K
Sbjct: 158 GSKPLFEREEIK 169


>AY569701-1|AAS86654.1|  407|Apis mellifera complementary sex
           determiner protein.
          Length = 407

 Score = 21.0 bits (42), Expect = 4.8
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +2

Query: 206 GSKPLFENISVK 241
           GSKPLFE   +K
Sbjct: 169 GSKPLFEREEIK 180


>AY569700-1|AAS86653.1|  407|Apis mellifera complementary sex
           determiner protein.
          Length = 407

 Score = 21.0 bits (42), Expect = 4.8
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +2

Query: 206 GSKPLFENISVK 241
           GSKPLFE   +K
Sbjct: 169 GSKPLFEREEIK 180


>AY569699-1|AAS86652.1|  396|Apis mellifera complementary sex
           determiner protein.
          Length = 396

 Score = 21.0 bits (42), Expect = 4.8
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +2

Query: 206 GSKPLFENISVK 241
           GSKPLFE   +K
Sbjct: 158 GSKPLFEREEIK 169


>AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule
           AbsCAM-Ig7B protein.
          Length = 1923

 Score = 21.0 bits (42), Expect = 4.8
 Identities = 14/45 (31%), Positives = 21/45 (46%), Gaps = 2/45 (4%)
 Frame = -3

Query: 262 RNGAAA--KFDGNVFKQRLTAELHGDVTGN*HRRILKRDMTNRAL 134
           RNG      F    F+Q + +  +  V  N   R+L RD+  RA+
Sbjct: 83  RNGTLVLLPFPAAAFRQDVHSAAYRCVASNSVGRVLSRDVQVRAV 127


>AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member
           AbsCAM-Ig7A protein.
          Length = 1919

 Score = 21.0 bits (42), Expect = 4.8
 Identities = 14/45 (31%), Positives = 21/45 (46%), Gaps = 2/45 (4%)
 Frame = -3

Query: 262 RNGAAA--KFDGNVFKQRLTAELHGDVTGN*HRRILKRDMTNRAL 134
           RNG      F    F+Q + +  +  V  N   R+L RD+  RA+
Sbjct: 83  RNGTLVLLPFPAAAFRQDVHSAAYRCVASNSVGRVLSRDVQVRAV 127


>X72575-1|CAA51167.1|  168|Apis mellifera Apidaecin precursor
           protein.
          Length = 168

 Score = 20.6 bits (41), Expect = 6.3
 Identities = 8/14 (57%), Positives = 10/14 (71%)
 Frame = -1

Query: 111 PAPRLRSTLKPKAK 70
           P PRLR   +PKA+
Sbjct: 56  PHPRLRREAEPKAE 69


>DQ667193-1|ABG75745.1|  510|Apis mellifera cys-loop ligand-gated
           ion channel subunit protein.
          Length = 510

 Score = 20.6 bits (41), Expect = 6.3
 Identities = 7/15 (46%), Positives = 9/15 (60%)
 Frame = +1

Query: 229 HFRQIWRRHRYGLIG 273
           +FRQ WR  R   +G
Sbjct: 88  YFRQSWRDSRLSFLG 102


>AF442148-1|AAL35349.1|  199|Apis mellifera apidaecin precursor
           protein.
          Length = 199

 Score = 20.6 bits (41), Expect = 6.3
 Identities = 8/14 (57%), Positives = 10/14 (71%)
 Frame = -1

Query: 111 PAPRLRSTLKPKAK 70
           P PRLR   KP+A+
Sbjct: 139 PHPRLRREAKPEAE 152


>AF084556-1|AAC71015.1|  652|Apis mellifera pipsqueak protein.
          Length = 652

 Score = 20.6 bits (41), Expect = 6.3
 Identities = 9/15 (60%), Positives = 10/15 (66%)
 Frame = -2

Query: 353 SRETLPSVGSRSPPR 309
           SR+  PSV   SPPR
Sbjct: 126 SRDGPPSVSLSSPPR 140


>AY569721-1|AAS86674.1|  400|Apis mellifera complementary sex
           determiner protein.
          Length = 400

 Score = 20.2 bits (40), Expect = 8.3
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = +2

Query: 206 GSKPLFENISVK 241
           GSKP+FE   +K
Sbjct: 158 GSKPIFEREEIK 169


>AY569719-1|AAS86672.1|  401|Apis mellifera feminizer protein.
          Length = 401

 Score = 20.2 bits (40), Expect = 8.3
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = +2

Query: 206 GSKPLFENISVK 241
           GSKP+FE   +K
Sbjct: 166 GSKPIFEREEIK 177


>AY569718-1|AAS86671.1|  401|Apis mellifera feminizer protein.
          Length = 401

 Score = 20.2 bits (40), Expect = 8.3
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = +2

Query: 206 GSKPLFENISVK 241
           GSKP+FE   +K
Sbjct: 166 GSKPIFEREEIK 177


>AY569717-1|AAS86670.1|  397|Apis mellifera complementary sex
           determiner protein.
          Length = 397

 Score = 20.2 bits (40), Expect = 8.3
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = +2

Query: 206 GSKPLFENISVK 241
           GSKP+FE   +K
Sbjct: 158 GSKPIFEREEIK 169


>AY569716-1|AAS86669.1|  406|Apis mellifera complementary sex
           determiner protein.
          Length = 406

 Score = 20.2 bits (40), Expect = 8.3
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = +2

Query: 206 GSKPLFENISVK 241
           GSKP+FE   +K
Sbjct: 169 GSKPIFEREEIK 180


>AY569715-1|AAS86668.1|  401|Apis mellifera feminizer protein.
          Length = 401

 Score = 20.2 bits (40), Expect = 8.3
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = +2

Query: 206 GSKPLFENISVK 241
           GSKP+FE   +K
Sbjct: 166 GSKPIFEREEIK 177


>AY569714-1|AAS86667.1|  401|Apis mellifera feminizer protein.
          Length = 401

 Score = 20.2 bits (40), Expect = 8.3
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = +2

Query: 206 GSKPLFENISVK 241
           GSKP+FE   +K
Sbjct: 166 GSKPIFEREEIK 177


>AY569713-1|AAS86666.1|  401|Apis mellifera feminizer protein.
          Length = 401

 Score = 20.2 bits (40), Expect = 8.3
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = +2

Query: 206 GSKPLFENISVK 241
           GSKP+FE   +K
Sbjct: 166 GSKPIFEREEIK 177


>AY569712-1|AAS86665.1|  408|Apis mellifera complementary sex
           determiner protein.
          Length = 408

 Score = 20.2 bits (40), Expect = 8.3
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = +2

Query: 206 GSKPLFENISVK 241
           GSKP+FE   +K
Sbjct: 169 GSKPIFEREEIK 180


>AY569711-1|AAS86664.1|  401|Apis mellifera feminizer protein.
          Length = 401

 Score = 20.2 bits (40), Expect = 8.3
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = +2

Query: 206 GSKPLFENISVK 241
           GSKP+FE   +K
Sbjct: 166 GSKPIFEREEIK 177


>AY569710-1|AAS86663.1|  408|Apis mellifera complementary sex
           determiner protein.
          Length = 408

 Score = 20.2 bits (40), Expect = 8.3
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = +2

Query: 206 GSKPLFENISVK 241
           GSKP+FE   +K
Sbjct: 169 GSKPIFEREEIK 180


>AY569709-1|AAS86662.1|  408|Apis mellifera complementary sex
           determiner protein.
          Length = 408

 Score = 20.2 bits (40), Expect = 8.3
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = +2

Query: 206 GSKPLFENISVK 241
           GSKP+FE   +K
Sbjct: 169 GSKPIFEREEIK 180


>AY569708-1|AAS86661.1|  408|Apis mellifera complementary sex
           determiner protein.
          Length = 408

 Score = 20.2 bits (40), Expect = 8.3
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = +2

Query: 206 GSKPLFENISVK 241
           GSKP+FE   +K
Sbjct: 169 GSKPIFEREEIK 180


>AY569707-1|AAS86660.1|  408|Apis mellifera complementary sex
           determiner protein.
          Length = 408

 Score = 20.2 bits (40), Expect = 8.3
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = +2

Query: 206 GSKPLFENISVK 241
           GSKP+FE   +K
Sbjct: 169 GSKPIFEREEIK 180


>AY569706-1|AAS86659.1|  397|Apis mellifera complementary sex
           determiner protein.
          Length = 397

 Score = 20.2 bits (40), Expect = 8.3
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = +2

Query: 206 GSKPLFENISVK 241
           GSKP+FE   +K
Sbjct: 158 GSKPIFEREEIK 169


>AY569705-1|AAS86658.1|  419|Apis mellifera complementary sex
           determiner protein.
          Length = 419

 Score = 20.2 bits (40), Expect = 8.3
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = +2

Query: 206 GSKPLFENISVK 241
           GSKP+FE   +K
Sbjct: 169 GSKPIFEREEIK 180


>AY569704-1|AAS86657.1|  426|Apis mellifera complementary sex
           determiner protein.
          Length = 426

 Score = 20.2 bits (40), Expect = 8.3
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = +2

Query: 206 GSKPLFENISVK 241
           GSKP+FE   +K
Sbjct: 169 GSKPIFEREEIK 180


>AY569702-1|AAS86655.1|  400|Apis mellifera feminizer protein.
          Length = 400

 Score = 20.2 bits (40), Expect = 8.3
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = +2

Query: 206 GSKPLFENISVK 241
           GSKP+FE   +K
Sbjct: 166 GSKPIFEREEIK 177


>AY569698-1|AAS86651.1|  407|Apis mellifera complementary sex
           determiner protein.
          Length = 407

 Score = 20.2 bits (40), Expect = 8.3
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = +2

Query: 206 GSKPLFENISVK 241
           GSKP+FE   +K
Sbjct: 169 GSKPIFEREEIK 180


>AY569697-1|AAS86650.1|  413|Apis mellifera complementary sex
           determiner protein.
          Length = 413

 Score = 20.2 bits (40), Expect = 8.3
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = +2

Query: 206 GSKPLFENISVK 241
           GSKP+FE   +K
Sbjct: 169 GSKPIFEREEIK 180


>AY569696-1|AAS86649.1|  414|Apis mellifera complementary sex
           determiner protein.
          Length = 414

 Score = 20.2 bits (40), Expect = 8.3
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = +2

Query: 206 GSKPLFENISVK 241
           GSKP+FE   +K
Sbjct: 169 GSKPIFEREEIK 180


>AY569695-1|AAS86648.1|  414|Apis mellifera complementary sex
           determiner protein.
          Length = 414

 Score = 20.2 bits (40), Expect = 8.3
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = +2

Query: 206 GSKPLFENISVK 241
           GSKP+FE   +K
Sbjct: 169 GSKPIFEREEIK 180


>AY569694-1|AAS86647.1|  400|Apis mellifera complementary sex
           determiner protein.
          Length = 400

 Score = 20.2 bits (40), Expect = 8.3
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = +2

Query: 206 GSKPLFENISVK 241
           GSKP+FE   +K
Sbjct: 158 GSKPIFEREEIK 169


>AY352277-1|AAQ67418.1|  418|Apis mellifera complementary sex
           determiner protein.
          Length = 418

 Score = 20.2 bits (40), Expect = 8.3
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = +2

Query: 206 GSKPLFENISVK 241
           GSKP+FE   +K
Sbjct: 174 GSKPIFEREEIK 185


>AY352276-1|AAQ67417.1|  385|Apis mellifera complementary sex
           determiner protein.
          Length = 385

 Score = 20.2 bits (40), Expect = 8.3
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = +2

Query: 206 GSKPLFENISVK 241
           GSKP+FE   +K
Sbjct: 169 GSKPIFEREEIK 180


>AY350618-1|AAQ57660.1|  425|Apis mellifera complementary sex
           determiner protein.
          Length = 425

 Score = 20.2 bits (40), Expect = 8.3
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = +2

Query: 206 GSKPLFENISVK 241
           GSKP+FE   +K
Sbjct: 169 GSKPIFEREEIK 180


>AY350617-1|AAQ57659.1|  428|Apis mellifera complementary sex
           determiner protein.
          Length = 428

 Score = 20.2 bits (40), Expect = 8.3
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = +2

Query: 206 GSKPLFENISVK 241
           GSKP+FE   +K
Sbjct: 169 GSKPIFEREEIK 180


>AY350616-1|AAQ57658.1|  401|Apis mellifera complementary sex
           determiner protein.
          Length = 401

 Score = 20.2 bits (40), Expect = 8.3
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = +2

Query: 206 GSKPLFENISVK 241
           GSKP+FE   +K
Sbjct: 166 GSKPIFEREEIK 177


>AY350615-1|AAQ57657.1|  410|Apis mellifera complementary sex
           determiner protein.
          Length = 410

 Score = 20.2 bits (40), Expect = 8.3
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = +2

Query: 206 GSKPLFENISVK 241
           GSKP+FE   +K
Sbjct: 169 GSKPIFEREEIK 180


>AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.
          Length = 1598

 Score = 20.2 bits (40), Expect = 8.3
 Identities = 7/20 (35%), Positives = 10/20 (50%)
 Frame = -1

Query: 288 TTTVRANQAVTVPPPNLTEM 229
           T     N + T PPP + E+
Sbjct: 677 TPNTTQNASATTPPPQVDEV 696


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 107,014
Number of Sequences: 438
Number of extensions: 1930
Number of successful extensions: 48
Number of sequences better than 10.0: 42
Number of HSP's better than 10.0 without gapping: 46
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 48
length of database: 146,343
effective HSP length: 51
effective length of database: 124,005
effective search space used:  9052365
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 39 (20.8 bits)

- SilkBase 1999-2023 -