BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0922 (810 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxy... 23 2.9 AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembran... 22 6.6 AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 22 6.6 >EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxylase protein. Length = 532 Score = 23.0 bits (47), Expect = 2.9 Identities = 15/49 (30%), Positives = 21/49 (42%), Gaps = 4/49 (8%) Frame = -3 Query: 598 EIAFWCIESKNVSLVSIRA*RSKDWNFFIATV----PQTPSSEYCRVWR 464 EIAF + + +K W TV P+ SEYCRV++ Sbjct: 238 EIAFAYKYGDPIPYIQYTETETKTWGSVFNTVLELMPKHACSEYCRVFK 286 >AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembrane transporter protein. Length = 669 Score = 21.8 bits (44), Expect = 6.6 Identities = 12/51 (23%), Positives = 28/51 (54%), Gaps = 1/51 (1%) Frame = -3 Query: 166 IRSRLIFD-ILDIGREDSYFEVSRASDEQNVIGMPINRCHSRTNGLLNMLR 17 ++ LIF +L + R+ SY + A E+ + + +++C + G+L ++ Sbjct: 169 VKEHLIFQALLRMDRDISYSQ-RMARVEEVISDLALSKCQNTPIGILGRIK 218 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 21.8 bits (44), Expect = 6.6 Identities = 12/51 (23%), Positives = 28/51 (54%), Gaps = 1/51 (1%) Frame = -3 Query: 166 IRSRLIFD-ILDIGREDSYFEVSRASDEQNVIGMPINRCHSRTNGLLNMLR 17 ++ LIF +L + R+ SY + A E+ + + +++C + G+L ++ Sbjct: 169 VKEHLIFQALLRMDRDISYSQ-RMARVEEVISDLALSKCQNTPIGILGRIK 218 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 183,994 Number of Sequences: 336 Number of extensions: 3875 Number of successful extensions: 9 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 22102797 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -