BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0922 (810 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein ... 26 1.2 AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcript... 24 4.8 AB090822-1|BAC57919.1| 468|Anopheles gambiae gag-like protein p... 24 6.4 >AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein protein. Length = 699 Score = 26.2 bits (55), Expect = 1.2 Identities = 15/52 (28%), Positives = 28/52 (53%) Frame = -2 Query: 341 FMTALPLVASVTLIELSWATQATLFPSAERKRCGPNRHLKANWETLLTVVLK 186 FM+ L + ++ L+ + +A A + PS + CGP R L + W+ + +K Sbjct: 501 FMSTLLISFTLALVPVVYAL-AEIVPS---RSCGPFRGLPSVWDRAIAAFMK 548 >AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcriptase protein. Length = 1168 Score = 24.2 bits (50), Expect = 4.8 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = +3 Query: 588 NAISCINIYKGTKSHTNKFSTSGLD 662 N C+ +KG ++ TN+F S D Sbjct: 155 NKADCLPTFKGNRADTNRFPPSRPD 179 >AB090822-1|BAC57919.1| 468|Anopheles gambiae gag-like protein protein. Length = 468 Score = 23.8 bits (49), Expect = 6.4 Identities = 9/33 (27%), Positives = 15/33 (45%) Frame = +3 Query: 489 EGVWGTVAMKKFQSLDRHARIETSDTFLDSIHQ 587 +G+W V +K + D S + S+HQ Sbjct: 188 DGIWREVTRRKSRRSDNRRNERESTQYQQSVHQ 220 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 825,677 Number of Sequences: 2352 Number of extensions: 16457 Number of successful extensions: 32 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 32 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 85655418 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -