BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0921 (829 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_5424| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_39188| Best HMM Match : Ion_trans (HMM E-Value=4.9e-20) 29 4.6 >SB_5424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 660 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/42 (28%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = +2 Query: 392 RADKTRWKVGCSDSLFHIFRIFMQ-FYYQNTSNFTIIEFLRG 514 R K RW +GC +LF + ++ + YY + + + ++L G Sbjct: 310 RDQKGRWDIGCQQTLFRNWTMYHRGGYYYSFQDCLVCDYLSG 351 >SB_39188| Best HMM Match : Ion_trans (HMM E-Value=4.9e-20) Length = 551 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/60 (23%), Positives = 28/60 (46%) Frame = +2 Query: 347 CSSLRASGFYIHSRGRADKTRWKVGCSDSLFHIFRIFMQFYYQNTSNFTIIEFLRGGVST 526 C ++ GF+IH R RA +T ++ + ++ + F+ S F + F + + T Sbjct: 27 CEAMEKKGFFIHPRSRAYRTLLRLQHNFLWAVVYLLDASFFLDIVSKFHLAFFEKASIIT 86 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,922,699 Number of Sequences: 59808 Number of extensions: 416786 Number of successful extensions: 893 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 819 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 893 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2323539746 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -