BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0917 (827 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. 25 0.73 AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 25 0.97 AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 22 5.2 U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. 22 6.8 AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 22 6.8 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 22 6.8 AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nu... 21 9.0 >AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. Length = 456 Score = 25.0 bits (52), Expect = 0.73 Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 2/55 (3%) Frame = +1 Query: 667 HPGFLRHCAHQGLHGTHLRHE--VEQRVHNRQXHKGVHLAAARQGHPLXNRPXNG 825 HPG++ A GL+ H+ H ++ H+ + +H A +P N G Sbjct: 13 HPGYMDGGAGAGLYEPHVAHRPGLQGLHHSPHLNHAMHPYHANHVNPTANHVMGG 67 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 24.6 bits (51), Expect = 0.97 Identities = 12/43 (27%), Positives = 19/43 (44%) Frame = -3 Query: 240 GSKHTSDDSSGKSPGASTRATCGDRLTVSVHTHRQVCPTSMLW 112 G+K + + K PG S GD + + V H T++ W Sbjct: 93 GNKRSIIVVNRKMPGPSVEVCLGDEVIIDVVNHLSSDSTTIHW 135 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 22.2 bits (45), Expect = 5.2 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = -1 Query: 614 IIHKFPDSNLMKSIIFVVAMSNWMESL 534 II +F L + VV +SNW E L Sbjct: 239 IIARFNIERLCNGLKRVVKLSNWREPL 265 >U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. Length = 470 Score = 21.8 bits (44), Expect = 6.8 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = +1 Query: 625 RNLGRVGTIVSRERHPGFLRHCAH 696 R LGR+ RE H ++ H ++ Sbjct: 302 RELGRIFRAYCRENHASWVNHLSN 325 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 21.8 bits (44), Expect = 6.8 Identities = 8/30 (26%), Positives = 15/30 (50%) Frame = -3 Query: 201 PGASTRATCGDRLTVSVHTHRQVCPTSMLW 112 PG S + GD++ + V H + ++ W Sbjct: 172 PGPSIQVCEGDKVVIDVENHIEGNEVTLHW 201 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 21.8 bits (44), Expect = 6.8 Identities = 8/30 (26%), Positives = 15/30 (50%) Frame = -3 Query: 201 PGASTRATCGDRLTVSVHTHRQVCPTSMLW 112 PG S + GD++ + V H + ++ W Sbjct: 172 PGPSIQVCEGDKVVIDVENHIEGNEVTLHW 201 >AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nuclear receptor protein. Length = 407 Score = 21.4 bits (43), Expect = 9.0 Identities = 12/37 (32%), Positives = 17/37 (45%) Frame = +1 Query: 595 SGNLCMITGGRNLGRVGTIVSRERHPGFLRHCAHQGL 705 S +LC I G R G+ + S E GF + + L Sbjct: 82 SKHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDL 118 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 201,063 Number of Sequences: 336 Number of extensions: 4690 Number of successful extensions: 14 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 22725411 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -