BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0916 (814 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC006790-13|AAF60737.2| 351|Caenorhabditis elegans Serpentine r... 29 3.0 >AC006790-13|AAF60737.2| 351|Caenorhabditis elegans Serpentine receptor, class z protein5 protein. Length = 351 Score = 29.5 bits (63), Expect = 3.0 Identities = 19/58 (32%), Positives = 31/58 (53%), Gaps = 5/58 (8%) Frame = -2 Query: 495 TFYGL-VC*VTTLKSLFIFINIILYV--LNTFCIYYFSTGGRENHNPSR--ICRYHNL 337 T Y + VC V L L++ ++I +V +C YF+ REN++P+ I +H L Sbjct: 9 TIYEISVCAVEGLMYLYVVLSIPCHVALFPFYCFAYFTNSLRENNSPTAPIIVHFHRL 66 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,233,100 Number of Sequences: 27780 Number of extensions: 399695 Number of successful extensions: 842 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 814 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 842 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1998381620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -