Bombyx BLAST Result against fruitfly

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= e96h0913
         (751 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X73975-1|CAA52155.1| 1146|Drosophila melanogaster integrin protein.    29   6.8  

>X73975-1|CAA52155.1| 1146|Drosophila melanogaster integrin protein.
          Length = 1146

 Score = 29.1 bits (62), Expect = 6.8
 Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 4/46 (8%)
 Frame = +2

Query: 392 RPTKITCVIWCNTKISCS--NSIV--ILLFFTNLFQFSGIQPLKKI 517
           +PT  TC  +  T ++CS  N IV     F T  FQ  G++P +KI
Sbjct: 708 KPTNATCNSYNTTLVACSLGNPIVRDTTTFVTIRFQPKGLEPSEKI 753


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 27,886,940
Number of Sequences: 53049
Number of extensions: 541324
Number of successful extensions: 885
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 873
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 884
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3417159966
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)