BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0906 (502 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g43560.1 68414.m05000 thioredoxin family protein contains Pfa... 59 2e-09 At1g19730.1 68414.m02465 thioredoxin H-type 4 (TRX-H-4) (GREN) i... 58 4e-09 At5g39950.1 68418.m04844 thioredoxin H-type 2 (TRX-H-2) (Gif2) i... 56 1e-08 At1g69880.1 68414.m08042 thioredoxin, putative similar to SP|Q38... 56 1e-08 At3g17880.1 68416.m02278 tetratricoredoxin (TDX) identical to te... 55 3e-08 At5g16400.1 68418.m01917 thioredoxin, putative similar to SP|P29... 54 5e-08 At1g76760.1 68414.m08933 thioredoxin family protein similar to t... 53 1e-07 At3g15360.1 68416.m01948 thioredoxin M-type 4, chloroplast (TRX-... 51 5e-07 At3g02730.1 68416.m00265 thioredoxin, putative similar to SP|P29... 51 5e-07 At5g42980.1 68418.m05242 thioredoxin H-type 3 (TRX-H-3) (GIF1) i... 50 7e-07 At4g26160.1 68417.m03765 thioredoxin family protein low similari... 50 9e-07 At1g45145.1 68414.m05175 thioredoxin H-type 5 (TRX-H-5) (TOUL) i... 50 1e-06 At1g03680.1 68414.m00347 thioredoxin M-type 1, chloroplast (TRX-... 49 2e-06 At3g08710.1 68416.m01012 thioredoxin family protein similar to t... 48 3e-06 At3g51030.1 68416.m05587 thioredoxin H-type 1 (TRX-H-1) identica... 48 4e-06 At4g03520.1 68417.m00480 thioredoxin M-type 2, chloroplast (TRX-... 47 6e-06 At2g33270.1 68415.m04078 thioredoxin family protein contains Pfa... 47 6e-06 At1g59730.1 68414.m06725 thioredoxin, putative similar to SP|Q38... 47 6e-06 At1g50320.1 68414.m05641 thioredoxin x nearly identical to thior... 46 1e-05 At4g29670.2 68417.m04227 thioredoxin family protein contains Pfa... 45 3e-05 At4g29670.1 68417.m04226 thioredoxin family protein contains Pfa... 45 3e-05 At1g08570.1 68414.m00950 thioredoxin family protein contains Pfa... 45 3e-05 At2g15570.1 68415.m01783 thioredoxin M-type 3, chloroplast (TRX-... 44 4e-05 At5g61440.1 68418.m07709 thioredoxin family protein low similari... 43 1e-04 At3g06730.1 68416.m00798 thioredoxin family protein contains Pfa... 41 5e-04 At1g21750.2 68414.m02723 protein disulfide isomerase, putative s... 38 0.003 At1g21750.1 68414.m02722 protein disulfide isomerase, putative s... 38 0.003 At1g77510.1 68414.m09026 protein disulfide isomerase, putative s... 38 0.005 At2g32920.1 68415.m04036 thioredoxin family protein similar to S... 36 0.012 At5g06690.1 68418.m00756 thioredoxin family protein low similiar... 36 0.015 At1g35620.1 68414.m04425 thioredoxin family protein similar to S... 36 0.015 At1g04980.1 68414.m00497 thioredoxin family protein similar to S... 36 0.015 At2g40790.1 68415.m05032 thioredoxin family protein contains Pfa... 35 0.027 At3g54960.1 68416.m06094 thioredoxin family protein similar to p... 35 0.035 At2g47470.2 68415.m05924 thioredoxin family protein similar to p... 35 0.035 At2g47470.1 68415.m05925 thioredoxin family protein similar to p... 35 0.035 At1g31020.1 68414.m03798 thioredoxin o (TRXO2) similar to thiore... 35 0.035 At5g04260.1 68418.m00417 thioredoxin family protein low similari... 34 0.047 At3g03860.1 68416.m00398 expressed protein 34 0.047 At2g35010.1 68415.m04295 thioredoxin family protein similar to S... 34 0.047 At1g60420.1 68414.m06802 DC1 domain-containing protein contains ... 34 0.047 At5g60640.2 68418.m07611 thioredoxin family protein similar to p... 33 0.11 At5g60640.1 68418.m07610 thioredoxin family protein similar to p... 33 0.11 At1g52990.1 68414.m05997 thioredoxin family protein similar to S... 32 0.19 At1g76080.1 68414.m08835 thioredoxin family protein low similari... 32 0.25 At3g56420.1 68416.m06275 thioredoxin family protein similar to t... 30 1.0 At1g43100.1 68414.m04965 glycoside hydrolase family 28 protein /... 29 1.8 At1g43090.1 68414.m04964 glycoside hydrolase family 28 protein /... 29 1.8 At1g43080.1 68414.m04963 glycoside hydrolase family 28 protein /... 29 1.8 At1g07700.3 68414.m00829 thioredoxin family protein low similari... 29 1.8 At1g07700.2 68414.m00827 thioredoxin family protein low similari... 29 1.8 At1g07700.1 68414.m00828 thioredoxin family protein low similari... 29 1.8 At4g31240.2 68417.m04435 expressed protein 28 4.1 At4g31240.1 68417.m04434 expressed protein 28 4.1 At5g61340.1 68418.m07697 expressed protein 27 5.4 At5g51290.1 68418.m06358 ceramide kinase-related contains weak s... 27 5.4 At4g13760.1 68417.m02135 glycoside hydrolase family 28 protein /... 27 5.4 At4g02330.1 68417.m00317 pectinesterase family protein contains ... 27 5.4 At3g53220.1 68416.m05864 thioredoxin family protein low similari... 27 7.1 At2g15460.1 68415.m01768 glycoside hydrolase family 28 protein /... 27 7.1 At2g15450.1 68415.m01767 glycoside hydrolase family 28 protein /... 27 7.1 At4g12050.1 68417.m01917 DNA-binding protein-related contains Pf... 27 9.4 At2g41680.1 68415.m05149 thioredoxin reductase, putative / NADPH... 27 9.4 >At1g43560.1 68414.m05000 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin; similar to thioredoxin GI:142153 from [Synechococcus PCC6301] Length = 167 Score = 58.8 bits (136), Expect = 2e-09 Identities = 24/73 (32%), Positives = 41/73 (56%) Frame = +3 Query: 54 LAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINS 233 L + DK V++DF ATWCGPC+++ P L+E++ + A++Y I + Sbjct: 71 LLQNSDKPVLVDFYATWCGPCQLMVPILNEVSETLKDIIAVVKIDTEKYPSLANKYQIEA 130 Query: 234 MPTFVLVRMARNW 272 +PTF+L + + W Sbjct: 131 LPTFILFKDGKLW 143 >At1g19730.1 68414.m02465 thioredoxin H-type 4 (TRX-H-4) (GREN) identical to SP|Q39239 Thioredoxin H-type 4 (TRX-H-4) {Arabidopsis thaliana} Length = 119 Score = 57.6 bits (133), Expect = 4e-09 Identities = 25/79 (31%), Positives = 41/79 (51%) Frame = +3 Query: 21 HIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXX 200 H D ++ A+ +KL+VIDF A+WC PC+MI P +++A + Sbjct: 12 HTNDVWTVQLDKAKESNKLIVIDFTASWCPPCRMIAPIFNDLAKKFMSSAIFFKVDVDEL 71 Query: 201 XXXASEYNINSMPTFVLVR 257 A E+ + +MPTFV ++ Sbjct: 72 QSVAKEFGVEAMPTFVFIK 90 >At5g39950.1 68418.m04844 thioredoxin H-type 2 (TRX-H-2) (Gif2) identical to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; identical to cDNA (Gif2) mRNA for thioredoxin GI:992963 Length = 133 Score = 56.0 bits (129), Expect = 1e-08 Identities = 25/66 (37%), Positives = 38/66 (57%) Frame = +3 Query: 69 DKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFV 248 +KL+V+DF A+WCGPC+MI P + + A+ A E+N+ +MPTFV Sbjct: 47 NKLLVVDFSASWCGPCRMIEPAIHAM-ADKFNDVDFVKLDVDELPDVAKEFNVTAMPTFV 105 Query: 249 LVRMAR 266 LV+ + Sbjct: 106 LVKRGK 111 >At1g69880.1 68414.m08042 thioredoxin, putative similar to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; contains Pfam profile: PF00085 Thioredoxin Length = 148 Score = 56.0 bits (129), Expect = 1e-08 Identities = 29/85 (34%), Positives = 46/85 (54%), Gaps = 2/85 (2%) Frame = +3 Query: 18 IHIKDSDDLKTRLAEAGD--KLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXX 191 + IK+ + K+RL D KL+VI+F A WCGPCK + PKL+E+AA+ Sbjct: 40 VEIKNMNQWKSRLNALKDTNKLLVIEFTAKWCGPCKTLEPKLEELAAKYTDVEFVKIDVD 99 Query: 192 XXXXXXASEYNINSMPTFVLVRMAR 266 E+N++++P V ++ R Sbjct: 100 VLMSVW-MEFNLSTLPAIVFMKRGR 123 >At3g17880.1 68416.m02278 tetratricoredoxin (TDX) identical to tetratricoredoxin [Arabidopsis thaliana] GI:18041544; similar to SP|Q42443 Thioredoxin H-type (TRX-H) (Phloem sap 13 kDa protein-1) {Oryza sativa}; contains Pfam profile: PF00085 Thioredoxin Length = 380 Score = 54.8 bits (126), Expect = 3e-08 Identities = 26/82 (31%), Positives = 42/82 (51%) Frame = +3 Query: 12 MSIHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXX 191 +SIH + KT+ A+ +L+++ F ATWCGPC+ + P +A + Sbjct: 273 ISIHSTSELEAKTKAAKKASRLLILYFTATWCGPCRYMSPLYSNLATQHSRVVFLKVDID 332 Query: 192 XXXXXXASEYNINSMPTFVLVR 257 AS +NI+S+PTF +R Sbjct: 333 KANDVAAS-WNISSVPTFCFIR 353 >At5g16400.1 68418.m01917 thioredoxin, putative similar to SP|P29450 Thioredoxin F-type, chloroplast precursor (TRX-F) {Pisum sativum}; contains Pfam profile: PF00085 Thioredoxin Length = 185 Score = 54.0 bits (124), Expect = 5e-08 Identities = 25/76 (32%), Positives = 36/76 (47%) Frame = +3 Query: 30 DSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXX 209 D D + AGDK+VV+D WCGPCK+I PK E++ + Sbjct: 84 DKDTFWPIVKAAGDKIVVLDMYTQWCGPCKVIAPKYKELSEKYQDMVFLKLDCNQDNKPL 143 Query: 210 ASEYNINSMPTFVLVR 257 A E I +PTF +++ Sbjct: 144 AKELGIRVVPTFKILK 159 >At1g76760.1 68414.m08933 thioredoxin family protein similar to thioredoxin CH2, M-type, chloroplast precursor GB:P23400 SP|P23400 [Chlamydomonas reinhardtii]; contains Pfam profile: PF00085 Thioredoxin Length = 172 Score = 52.8 bits (121), Expect = 1e-07 Identities = 21/63 (33%), Positives = 36/63 (57%) Frame = +3 Query: 69 DKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFV 248 DK V++D+ ATWCGPC+ + P L+E++ + A++Y I ++PTF+ Sbjct: 81 DKPVLVDYYATWCGPCQFMVPILNEVSETLKDKIQVVKIDTEKYPSIANKYKIEALPTFI 140 Query: 249 LVR 257 L + Sbjct: 141 LFK 143 >At3g15360.1 68416.m01948 thioredoxin M-type 4, chloroplast (TRX-M4) nearly identical to SP|Q9SEU6 Thioredoxin M-type 4, chloroplast precursor (TRX-M4) {Arabidopsis thaliana} Length = 193 Score = 50.8 bits (116), Expect = 5e-07 Identities = 24/79 (30%), Positives = 44/79 (55%) Frame = +3 Query: 21 HIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXX 200 ++ DS+ +T++ E+ D V+++F A WCGPC+MI P +D++A + Sbjct: 90 NLSDSE-WQTKVLES-DVPVLVEFWAPWCGPCRMIHPIVDQLAKDFAGKFKFYKINTDES 147 Query: 201 XXXASEYNINSMPTFVLVR 257 A+ Y I S+PT ++ + Sbjct: 148 PNTANRYGIRSVPTVIIFK 166 >At3g02730.1 68416.m00265 thioredoxin, putative similar to SP|P29450 Thioredoxin F-type, chloroplast precursor (TRX-F) {Pisum sativum}; contains Pfam profile: PF00085 Thioredoxin Length = 178 Score = 50.8 bits (116), Expect = 5e-07 Identities = 24/76 (31%), Positives = 35/76 (46%) Frame = +3 Query: 30 DSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXX 209 D D + AG+KLVV+D WCGPCK+I PK ++ + Sbjct: 74 DKDTFWPIVKAAGEKLVVLDMYTQWCGPCKVIAPKYKALSEKYDDVVFLKLDCNPDNRPL 133 Query: 210 ASEYNINSMPTFVLVR 257 A E I +PTF +++ Sbjct: 134 AKELGIRVVPTFKILK 149 >At5g42980.1 68418.m05242 thioredoxin H-type 3 (TRX-H-3) (GIF1) identical to SP|Q42403 Thioredoxin H-type 3 (TRX-H-3) {Arabidopsis thaliana}; identical to cDNA (GIF1) mRNA for thioredoxin GI:992961 Length = 118 Score = 50.4 bits (115), Expect = 7e-07 Identities = 23/71 (32%), Positives = 35/71 (49%) Frame = +3 Query: 45 KTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYN 224 K + A KL+VIDF ATWC PC+ I P ++ A+ A E+ Sbjct: 19 KLKAANESKKLIVIDFTATWCPPCRFIAPVFADL-AKKHLDVVFFKVDVDELNTVAEEFK 77 Query: 225 INSMPTFVLVR 257 + +MPTF+ ++ Sbjct: 78 VQAMPTFIFMK 88 >At4g26160.1 68417.m03765 thioredoxin family protein low similarity to thioredoxin [Ictalurus punctatus] GI:9837585; contains Pfam profile: PF00085 Thioredoxin Length = 221 Score = 50.0 bits (114), Expect = 9e-07 Identities = 22/50 (44%), Positives = 31/50 (62%) Frame = +3 Query: 6 PKMSIHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAE 155 P M I I ++ L +AGD+LV++DF TWCG C+ + PKL + A E Sbjct: 93 PNM-IDITSAEQFLNALKDAGDRLVIVDFYGTWCGSCRAMFPKLCKTAKE 141 >At1g45145.1 68414.m05175 thioredoxin H-type 5 (TRX-H-5) (TOUL) identical to SP|Q39241 Thioredoxin H-type 5 (TRX-H-5) {Arabidopsis thaliana}; identical to cDNA (TOUL) mRNA for thioredoxin GI:992965 Length = 118 Score = 49.6 bits (113), Expect = 1e-06 Identities = 24/71 (33%), Positives = 35/71 (49%) Frame = +3 Query: 45 KTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYN 224 K + A KL+VIDF A+WC PC+ I P E+A + A E+ Sbjct: 19 KVKDANESKKLIVIDFTASWCPPCRFIAPVFAEMAKKF-TNVVFFKIDVDELQAVAQEFK 77 Query: 225 INSMPTFVLVR 257 + +MPTFV ++ Sbjct: 78 VEAMPTFVFMK 88 >At1g03680.1 68414.m00347 thioredoxin M-type 1, chloroplast (TRX-M1) nearly identical to SP|O48737 Thioredoxin M-type 1, chloroplast precursor (TRX-M1) {Arabidopsis thaliana}; similar to ESTs gb|T13714, gb|H76398, gb|N37762, gb|AA042639, gb|T21104, emb|Z30901 Length = 179 Score = 49.2 bits (112), Expect = 2e-06 Identities = 25/97 (25%), Positives = 41/97 (42%) Frame = +3 Query: 33 SDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXA 212 +D L D+ V +DF A WCGPCKMI P ++E+A + Sbjct: 80 NDSTWDSLVLKADEPVFVDFWAPWCGPCKMIDPIVNELAQKYAGQFKFYKLNTDESPATP 139 Query: 213 SEYNINSMPTFVLVRMARNWTNSLALTSTNSKQLSLN 323 +Y + S+PT ++ + S ++ S+N Sbjct: 140 GQYGVRSIPTIMIFVNGEKKDTIIGAVSKDTLATSIN 176 >At3g08710.1 68416.m01012 thioredoxin family protein similar to thioredoxin H-type GB:P29448 SP|P29448 [Arabidopsis thaliana], Thioredoxin H-type 2 (TRX-H2) SP|Q07090 {Nicotiana tabacum}; contains Pfam profile: PF00085 Thioredoxin Length = 140 Score = 48.4 bits (110), Expect = 3e-06 Identities = 26/80 (32%), Positives = 40/80 (50%) Frame = +3 Query: 18 IHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXX 197 I K+S D K A+ K+VV +F ATWCGPCK++ P E+ +E Sbjct: 28 ITTKESWDDKLAEADRDGKIVVANFSATWCGPCKIVAPFFIEL-SEKHSSLMFLLVDVDE 86 Query: 198 XXXXASEYNINSMPTFVLVR 257 +S ++I + PTF ++ Sbjct: 87 LSDFSSSWDIKATPTFFFLK 106 >At3g51030.1 68416.m05587 thioredoxin H-type 1 (TRX-H-1) identical to SP|P29448 Thioredoxin H-type 1 (TRX-H-1) {Arabidopsis thaliana} Length = 114 Score = 48.0 bits (109), Expect = 4e-06 Identities = 23/82 (28%), Positives = 43/82 (52%) Frame = +3 Query: 12 MSIHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXX 191 ++ H ++ + + + A LVV+DF A+WCGPC+ I P ++A ++ Sbjct: 9 IACHTVETWNEQLQKANESKTLVVVDFTASWCGPCRFIAPFFADLAKKL-PNVLFLKVDT 67 Query: 192 XXXXXXASEYNINSMPTFVLVR 257 AS++ I +MPTF+ ++ Sbjct: 68 DELKSVASDWAIQAMPTFMFLK 89 >At4g03520.1 68417.m00480 thioredoxin M-type 2, chloroplast (TRX-M2) nearly identical to SP|Q9SEU8 Thioredoxin M-type 2, chloroplast precursor (TRX-M2) {Arabidopsis thaliana} Length = 186 Score = 47.2 bits (107), Expect = 6e-06 Identities = 19/58 (32%), Positives = 29/58 (50%) Frame = +3 Query: 78 VVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFVL 251 VV+DF A WCGPCKMI P ++++A +Y + S+PT ++ Sbjct: 101 VVVDFWAPWCGPCKMIDPLVNDLAQHYTGKIKFYKLNTDESPNTPGQYGVRSIPTIMI 158 >At2g33270.1 68415.m04078 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin Length = 273 Score = 47.2 bits (107), Expect = 6e-06 Identities = 23/49 (46%), Positives = 29/49 (59%) Frame = +3 Query: 3 KPKMSIHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIA 149 KP M + DL L AGDKLVV+DF + CG CK + PK+ +IA Sbjct: 92 KPNMK-SVTSPQDLVVSLRNAGDKLVVVDFFSPSCGGCKALHPKICKIA 139 >At1g59730.1 68414.m06725 thioredoxin, putative similar to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; contains Pfam profile: PF00085 Thioredoxin Length = 129 Score = 47.2 bits (107), Expect = 6e-06 Identities = 23/66 (34%), Positives = 34/66 (51%) Frame = +3 Query: 60 EAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMP 239 + +KL+VIDF A WCGPCK + P++ EIA++ A Y ++P Sbjct: 40 KGSNKLLVIDFTAVWCGPCKAMEPRVREIASK-YSEAVFARVDVDRLMDVAGTYRAITLP 98 Query: 240 TFVLVR 257 FV V+ Sbjct: 99 AFVFVK 104 >At1g50320.1 68414.m05641 thioredoxin x nearly identical to thioredoxin x GB:AAF15952 GI:6539616 from [Arabidopsis thaliana] Length = 182 Score = 46.0 bits (104), Expect = 1e-05 Identities = 17/60 (28%), Positives = 32/60 (53%) Frame = +3 Query: 78 VVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFVLVR 257 V+++F+ATWCGPCK+I P ++ ++ E +E+ + +P F+L + Sbjct: 90 VLVEFVATWCGPCKLIYPAMEALSQEYGDKLTIVKIDHDANPKLIAEFKVYGLPHFILFK 149 >At4g29670.2 68417.m04227 thioredoxin family protein contains Pfam profile PF00085: Thioredoxin Length = 236 Score = 45.2 bits (102), Expect = 3e-05 Identities = 18/50 (36%), Positives = 32/50 (64%) Frame = +3 Query: 6 PKMSIHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAE 155 P M + I +++ + L+ AG++LV+++F TWC C+ + PKL + A E Sbjct: 103 PNM-VDIHSTEEFLSALSGAGERLVIVEFYGTWCASCRALFPKLCKTAVE 151 >At4g29670.1 68417.m04226 thioredoxin family protein contains Pfam profile PF00085: Thioredoxin Length = 235 Score = 45.2 bits (102), Expect = 3e-05 Identities = 18/50 (36%), Positives = 32/50 (64%) Frame = +3 Query: 6 PKMSIHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAE 155 P M + I +++ + L+ AG++LV+++F TWC C+ + PKL + A E Sbjct: 103 PNM-VDIHSTEEFLSALSGAGERLVIVEFYGTWCASCRALFPKLCKTAVE 151 >At1g08570.1 68414.m00950 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin; similar to ESTs gb|T46281, gb|R83933, gb|N65879, emb|F14466, gb|N96726, gb|AA042340, and emb|Z18150 Length = 275 Score = 45.2 bits (102), Expect = 3e-05 Identities = 27/96 (28%), Positives = 42/96 (43%) Frame = +3 Query: 24 IKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXX 203 I + +L L AGDKLVV+DF + CG CK + PK+ + AEM Sbjct: 102 ISSAQELVDSLTNAGDKLVVVDFFSPGCGGCKALHPKICQF-AEMNPDVQFLQVNYEEHK 160 Query: 204 XXASEYNINSMPTFVLVRMARNWTNSLALTSTNSKQ 311 ++ +P F R ++ S + T+ K+ Sbjct: 161 SMCYSLGVHVLPFFRFYRGSQGRVCSFSCTNATIKK 196 >At2g15570.1 68415.m01783 thioredoxin M-type 3, chloroplast (TRX-M3) identical to SP|Q9SEU7 Thioredoxin M-type 3, chloroplast precursor (TRX-M3) {Arabidopsis thaliana} Length = 173 Score = 44.4 bits (100), Expect = 4e-05 Identities = 18/60 (30%), Positives = 30/60 (50%) Frame = +3 Query: 78 VVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFVLVR 257 V+++F +WCGPC+M+ +DEIA + A EY I ++P +L + Sbjct: 87 VLVEFYTSWCGPCRMVHRIIDEIAGDYAGKLNCYLLNADNDLPVAEEYEIKAVPVVLLFK 146 >At5g61440.1 68418.m07709 thioredoxin family protein low similarity to thioredoxin [Callithrix jacchus] GI:13560979; contains Pfam profile: PF00085 Thioredoxin Length = 245 Score = 43.2 bits (97), Expect = 1e-04 Identities = 18/44 (40%), Positives = 29/44 (65%) Frame = +3 Query: 18 IHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIA 149 + I+ ++ L L AGD+LVV+DF + CG CK + PK+ ++A Sbjct: 88 LEIQSANHLVDSLLNAGDRLVVLDFYSPGCGGCKSLHPKICQLA 131 >At3g06730.1 68416.m00798 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin Length = 183 Score = 40.7 bits (91), Expect = 5e-04 Identities = 18/65 (27%), Positives = 30/65 (46%), Gaps = 2/65 (3%) Frame = +3 Query: 66 GDKLV--VIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMP 239 GD+ V ++DF ATWCGPC ++ +L+ +A E A + + +P Sbjct: 91 GDRKVPLIVDFYATWCGPCILMAQELEMLAVEYESNAIIVKVDTDDEYEFARDMQVRGLP 150 Query: 240 TFVLV 254 T + Sbjct: 151 TLFFI 155 >At1g21750.2 68414.m02723 protein disulfide isomerase, putative similar to SP|P29828 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Medicago sativa}; isoform contains non-consensus GA donor splice site at intron 9 Length = 487 Score = 38.3 bits (85), Expect = 0.003 Identities = 17/39 (43%), Positives = 25/39 (64%) Frame = +3 Query: 33 SDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIA 149 SD L + +G K V+++F A WCG C+ + P LDE+A Sbjct: 381 SDSLDDIVLNSG-KNVLLEFYAPWCGHCQKLAPILDEVA 418 Score = 34.3 bits (75), Expect = 0.047 Identities = 10/27 (37%), Positives = 19/27 (70%) Frame = +3 Query: 78 VVIDFMATWCGPCKMIGPKLDEIAAEM 158 +V++F A WCG CK + P+ ++ A+ + Sbjct: 50 IVVEFYAPWCGHCKQLAPEYEKAASAL 76 >At1g21750.1 68414.m02722 protein disulfide isomerase, putative similar to SP|P29828 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Medicago sativa}; isoform contains non-consensus GA donor splice site at intron 9 Length = 501 Score = 38.3 bits (85), Expect = 0.003 Identities = 17/39 (43%), Positives = 25/39 (64%) Frame = +3 Query: 33 SDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIA 149 SD L + +G K V+++F A WCG C+ + P LDE+A Sbjct: 381 SDSLDDIVLNSG-KNVLLEFYAPWCGHCQKLAPILDEVA 418 Score = 34.3 bits (75), Expect = 0.047 Identities = 10/27 (37%), Positives = 19/27 (70%) Frame = +3 Query: 78 VVIDFMATWCGPCKMIGPKLDEIAAEM 158 +V++F A WCG CK + P+ ++ A+ + Sbjct: 50 IVVEFYAPWCGHCKQLAPEYEKAASAL 76 >At1g77510.1 68414.m09026 protein disulfide isomerase, putative similar to protein disulfide isomerase precursor GB:P29828 GI:4704766 [Medicago sativa]; Pfam HMM hit: PF00085 Thioredoxins Length = 508 Score = 37.5 bits (83), Expect = 0.005 Identities = 20/56 (35%), Positives = 32/56 (57%), Gaps = 7/56 (12%) Frame = +3 Query: 3 KPKMSIHIKDSDDLKTRLAEAGD-------KLVVIDFMATWCGPCKMIGPKLDEIA 149 K I ++++ +K +AE+ D K V+I+F A WCG C+ + P LDE+A Sbjct: 361 KKSQPIPAENNEPVKVVVAESLDDIVFKSGKNVLIEFYAPWCGHCQKLAPILDEVA 416 Score = 35.9 bits (79), Expect = 0.015 Identities = 17/65 (26%), Positives = 30/65 (46%), Gaps = 5/65 (7%) Frame = +3 Query: 78 VVIDFMATWCGPCKMIGPKLDEIAAEM-----XXXXXXXXXXXXXXXXXASEYNINSMPT 242 +V++F A WCG C+ + P+ ++ A+E+ A+EY I PT Sbjct: 49 IVVEFYAPWCGHCQKLAPEYEKAASELSSHNPPLALAKIDASEEANKEFANEYKIQGFPT 108 Query: 243 FVLVR 257 ++R Sbjct: 109 LKILR 113 >At2g32920.1 68415.m04036 thioredoxin family protein similar to SP|Q15084 Protein disulfide isomerase A6 precursor (EC 5.3.4.1) {Homo sapiens}; contains Pfam profile PF00085: Thioredoxin Length = 440 Score = 36.3 bits (80), Expect = 0.012 Identities = 15/56 (26%), Positives = 25/56 (44%) Frame = +3 Query: 75 LVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPT 242 +V+++F A WCG CK + P +++A + A +Y I PT Sbjct: 50 VVLVEFFAPWCGHCKALTPTWEKVANILKGVATVAAIDADAHQSAAQDYGIKGFPT 105 Score = 34.3 bits (75), Expect = 0.047 Identities = 19/85 (22%), Positives = 34/85 (40%), Gaps = 2/85 (2%) Frame = +3 Query: 3 KPKMSIHIKDS--DDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXX 176 +P S+ + S DDL ++L +++F A WCG CK + P+ A + Sbjct: 160 EPSASVELNASNFDDLVIE----SNELWIVEFFAPWCGHCKKLAPEWKRAAKNLQGKVKL 215 Query: 177 XXXXXXXXXXXASEYNINSMPTFVL 251 S + + PT ++ Sbjct: 216 GHVNCDVEQSIMSRFKVQGFPTILV 240 >At5g06690.1 68418.m00756 thioredoxin family protein low similiarity to SP|P34723 Thioredoxin {Penicillium chrysogenum}; contains Pfam profile: PF00085 Thioredoxin Length = 210 Score = 35.9 bits (79), Expect = 0.015 Identities = 12/26 (46%), Positives = 21/26 (80%) Frame = +3 Query: 78 VVIDFMATWCGPCKMIGPKLDEIAAE 155 ++I++MA+WC C + PKL+++AAE Sbjct: 121 IIIEWMASWCRKCIYLKPKLEKLAAE 146 >At1g35620.1 68414.m04425 thioredoxin family protein similar to SP|Q43116 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Ricinus communis}; contains Pfam profile PF00085: Thioredoxin Length = 440 Score = 35.9 bits (79), Expect = 0.015 Identities = 18/61 (29%), Positives = 28/61 (45%), Gaps = 3/61 (4%) Frame = +3 Query: 78 VVIDFMATWCGPCKMIGPKLD---EIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFV 248 + +DF A WCG CK + P+LD I A++ A + I++ PT + Sbjct: 52 IFVDFYAPWCGHCKRLNPELDAAAPILAKLKQPIVIAKLNADKYSRLARKIEIDAFPTLM 111 Query: 249 L 251 L Sbjct: 112 L 112 >At1g04980.1 68414.m00497 thioredoxin family protein similar to SP|Q63081 Protein disulfide isomerase A6 precursor (EC 5.3.4.1) {Rattus norvegicus}; contains Pfam profile PF00085: Thioredoxin Length = 443 Score = 35.9 bits (79), Expect = 0.015 Identities = 20/85 (23%), Positives = 35/85 (41%), Gaps = 2/85 (2%) Frame = +3 Query: 3 KPKMSIHIKDS--DDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXX 176 +P S+ + S D+L T E L +++F A WCG CK + P+ + A + Sbjct: 161 EPSASVELNSSNFDELVTESKE----LWIVEFFAPWCGHCKKLAPEWKKAANNLKGKVKL 216 Query: 177 XXXXXXXXXXXASEYNINSMPTFVL 251 S + + PT ++ Sbjct: 217 GHVNCDAEQSIKSRFKVQGFPTILV 241 Score = 35.1 bits (77), Expect = 0.027 Identities = 12/56 (21%), Positives = 26/56 (46%) Frame = +3 Query: 75 LVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPT 242 +V+++F A WCG C+ + P +++A+ + + +Y + PT Sbjct: 48 VVLVEFFAPWCGHCQSLTPTWEKVASTLKGIATVAAIDADAHKSVSQDYGVRGFPT 103 >At2g40790.1 68415.m05032 thioredoxin family protein contains Pfam profile: PF00085 thioredoxin Length = 154 Score = 35.1 bits (77), Expect = 0.027 Identities = 19/70 (27%), Positives = 34/70 (48%) Frame = +3 Query: 57 AEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSM 236 A + K++V++F A+WC P K I P E+A+ + E+N+++ Sbjct: 58 ANSHGKILVVNFKASWCLPSKTILPIYQELAS-TYTSMIFVTIDVEELAEFSHEWNVDAT 116 Query: 237 PTFVLVRMAR 266 PT V ++ R Sbjct: 117 PTVVFLKDGR 126 >At3g54960.1 68416.m06094 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 579 Score = 34.7 bits (76), Expect = 0.035 Identities = 15/61 (24%), Positives = 24/61 (39%) Frame = +3 Query: 69 DKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFV 248 + +++F A WCG C+ + P+ A E+ A +Y I PT Sbjct: 116 NSFAMVEFYAPWCGACQALTPEYAAAATELKGLAALAKIDATEEGDLAQKYEIQGFPTVF 175 Query: 249 L 251 L Sbjct: 176 L 176 >At2g47470.2 68415.m05924 thioredoxin family protein similar to protein disulfide isomerase [Dictyostelium discoideum] GI:2627440; contains Pfam profile: PF00085 Thioredoxin Length = 266 Score = 34.7 bits (76), Expect = 0.035 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = +3 Query: 69 DKLVVIDFMATWCGPCKMIGPKLDEIAA 152 DK +++F A WCG CK + P+ +++ A Sbjct: 40 DKGALVEFYAPWCGHCKKLAPEYEKLGA 67 Score = 33.9 bits (74), Expect = 0.062 Identities = 11/27 (40%), Positives = 19/27 (70%) Frame = +3 Query: 69 DKLVVIDFMATWCGPCKMIGPKLDEIA 149 +K V+++F A WCG CK + P +++A Sbjct: 159 NKDVLVEFYAPWCGHCKSLAPTYEKVA 185 >At2g47470.1 68415.m05925 thioredoxin family protein similar to protein disulfide isomerase [Dictyostelium discoideum] GI:2627440; contains Pfam profile: PF00085 Thioredoxin Length = 361 Score = 34.7 bits (76), Expect = 0.035 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = +3 Query: 69 DKLVVIDFMATWCGPCKMIGPKLDEIAA 152 DK +++F A WCG CK + P+ +++ A Sbjct: 40 DKGALVEFYAPWCGHCKKLAPEYEKLGA 67 Score = 33.9 bits (74), Expect = 0.062 Identities = 11/27 (40%), Positives = 19/27 (70%) Frame = +3 Query: 69 DKLVVIDFMATWCGPCKMIGPKLDEIA 149 +K V+++F A WCG CK + P +++A Sbjct: 159 NKDVLVEFYAPWCGHCKSLAPTYEKVA 185 >At1g31020.1 68414.m03798 thioredoxin o (TRXO2) similar to thioredoxin 2 from Saccharomyces cerevisiae GI:173050, 3'-end of protein contains similarity to thioredoxins; contains Pfam profile: PF00085 Thioredoxin; identical to cDNA thioredoxin o (TRXO2) GI:15081458 Length = 159 Score = 34.7 bits (76), Expect = 0.035 Identities = 15/44 (34%), Positives = 26/44 (59%), Gaps = 2/44 (4%) Frame = +3 Query: 24 IKDSDDLKTRLAEAGDKLV--VIDFMATWCGPCKMIGPKLDEIA 149 +K + + L++A D + V F A WCGPC++I P + E++ Sbjct: 54 LKSEAEFNSALSKARDGSLPSVFYFTAAWCGPCRLISPVILELS 97 >At5g04260.1 68418.m00417 thioredoxin family protein low similarity to SP|P29429 Thioredoxin. [Aspergillus nidulans] {Emericella nidulans}; contains Pfam profile: PF00085 Thioredoxin Length = 192 Score = 34.3 bits (75), Expect = 0.047 Identities = 14/26 (53%), Positives = 19/26 (73%) Frame = +3 Query: 78 VVIDFMATWCGPCKMIGPKLDEIAAE 155 VVI +MA WC C + PKL+++AAE Sbjct: 101 VVIVWMAAWCRKCIYLKPKLEKLAAE 126 >At3g03860.1 68416.m00398 expressed protein Length = 300 Score = 34.3 bits (75), Expect = 0.047 Identities = 19/81 (23%), Positives = 35/81 (43%), Gaps = 1/81 (1%) Frame = +3 Query: 30 DSDDLKTRLA-EAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXX 206 D D L +A + G+ + + F A+WC + + PK D +++ Sbjct: 60 DGDSLDRLMASQHGNAYMSVLFYASWCPFSRAVRPKFDMLSSMFPQIQHLAVEHSQALPS 119 Query: 207 XASEYNINSMPTFVLVRMARN 269 S Y I+S+P+ ++V N Sbjct: 120 VFSRYGIHSLPSILMVNQTLN 140 >At2g35010.1 68415.m04295 thioredoxin family protein similar to SP|Q42443 Thioredoxin H-type (TRX-H) {Oryza sativa}; contains Pfam profile: PF00085 Thioredoxin Length = 194 Score = 34.3 bits (75), Expect = 0.047 Identities = 14/46 (30%), Positives = 26/46 (56%), Gaps = 2/46 (4%) Frame = +3 Query: 24 IKDSDDLKTRLAEAGDKLV--VIDFMATWCGPCKMIGPKLDEIAAE 155 +K ++ +++A D + V F A WCGPC+ I P + E++ + Sbjct: 89 VKSEEEFINAMSKAQDGSLPSVFYFTAAWCGPCRFISPVIVELSKQ 134 >At1g60420.1 68414.m06802 DC1 domain-containing protein contains Pfam domain PF03107: DC1 domain Length = 578 Score = 34.3 bits (75), Expect = 0.047 Identities = 13/42 (30%), Positives = 23/42 (54%) Frame = +3 Query: 21 HIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEI 146 ++ D K +++ K +++ F A WC PC+ PKL E+ Sbjct: 347 YVLGKDGAKVLVSDLVGKTILMYFSAHWCPPCRAFTPKLVEV 388 Score = 32.7 bits (71), Expect = 0.14 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +3 Query: 72 KLVVIDFMATWCGPCKMIGPKLDEIAAEM 158 K + + F A WCGPC+ P+L E+ E+ Sbjct: 44 KKIGLYFSAAWCGPCQRFTPQLVEVYNEL 72 >At5g60640.2 68418.m07611 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 536 Score = 33.1 bits (72), Expect = 0.11 Identities = 15/61 (24%), Positives = 26/61 (42%), Gaps = 1/61 (1%) Frame = +3 Query: 69 DKLVVIDFMATWCGPCKMIGPKLDEIAAEM-XXXXXXXXXXXXXXXXXASEYNINSMPTF 245 ++ V+++F A WCG C+ + P+ A E+ A EY + PT Sbjct: 120 NQYVLVEFYAPWCGHCQSLAPEYAAAATELKEDGVVLAKIDATEENELAQEYRVQGFPTL 179 Query: 246 V 248 + Sbjct: 180 L 180 Score = 27.5 bits (58), Expect = 5.4 Identities = 9/29 (31%), Positives = 18/29 (62%) Frame = +3 Query: 72 KLVVIDFMATWCGPCKMIGPKLDEIAAEM 158 K V+++ A WCG C+ + P +++A + Sbjct: 460 KDVLLEVYAPWCGHCQALEPMYNKLAKHL 488 >At5g60640.1 68418.m07610 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 597 Score = 33.1 bits (72), Expect = 0.11 Identities = 15/61 (24%), Positives = 26/61 (42%), Gaps = 1/61 (1%) Frame = +3 Query: 69 DKLVVIDFMATWCGPCKMIGPKLDEIAAEM-XXXXXXXXXXXXXXXXXASEYNINSMPTF 245 ++ V+++F A WCG C+ + P+ A E+ A EY + PT Sbjct: 120 NQYVLVEFYAPWCGHCQSLAPEYAAAATELKEDGVVLAKIDATEENELAQEYRVQGFPTL 179 Query: 246 V 248 + Sbjct: 180 L 180 Score = 27.5 bits (58), Expect = 5.4 Identities = 9/29 (31%), Positives = 18/29 (62%) Frame = +3 Query: 72 KLVVIDFMATWCGPCKMIGPKLDEIAAEM 158 K V+++ A WCG C+ + P +++A + Sbjct: 460 KDVLLEVYAPWCGHCQALEPMYNKLAKHL 488 >At1g52990.1 68414.m05997 thioredoxin family protein similar to SP|P48384 Thioredoxin M-type, chloroplast precursor (TRX-M) {Pisum sativum}; contains Pfam profile PF00085: Thioredoxin Length = 313 Score = 32.3 bits (70), Expect = 0.19 Identities = 14/60 (23%), Positives = 29/60 (48%) Frame = +3 Query: 78 VVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFVLVR 257 V++ F A WCGPC+ + P L+++ +E ++I+ +PT ++ + Sbjct: 230 VMVMFTARWCGPCRDMIPILNKMDSEYKNEFKFYTVNFDTEIRFTERFDISYLPTTLVFK 289 >At1g76080.1 68414.m08835 thioredoxin family protein low similarity to thioredoxin (TRX) [Fasciola hepatica] GI:6687568; contains Pfam profile PF00085: Thioredoxin Length = 302 Score = 31.9 bits (69), Expect = 0.25 Identities = 18/67 (26%), Positives = 27/67 (40%), Gaps = 3/67 (4%) Frame = +3 Query: 66 GDKLVVIDFMATWCGPCKMIGP---KLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSM 236 G KL+V+D CGPC + P KL +E + N+ + Sbjct: 206 GGKLIVLDVGLKHCGPCVKVYPTVLKLSRSMSETVVFARMNGDENDSCMEFLKDMNVIEV 265 Query: 237 PTFVLVR 257 PTF+ +R Sbjct: 266 PTFLFIR 272 >At3g56420.1 68416.m06275 thioredoxin family protein similar to thioredoxin [Nicotiana tabacum] GI:20047; contains Pfam profile: PF00085 Thioredoxin Length = 100 Score = 29.9 bits (64), Expect = 1.0 Identities = 15/57 (26%), Positives = 25/57 (43%) Frame = +3 Query: 96 ATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFVLVRMAR 266 A WC PCK I P ++A+ ++E+N+ + PT V ++ R Sbjct: 17 APWCVPCKKIEPVFRDLASR-YPSMIFVTVDVEELAEFSNEWNVEATPTVVFLKDGR 72 >At1g43100.1 68414.m04965 glycoside hydrolase family 28 protein / polygalacturonase (pectinase) family protein similar to SP|P35339 Exopolygalacturonase precursor (EC 3.2.1.67) (Pectinase) (Galacturan 1,4-alpha-galacturonidase) {Zea mays}; contains Pfam profile PF00295: Glycosyl hydrolases family 28 (polygalacturonases) Length = 444 Score = 29.1 bits (62), Expect = 1.8 Identities = 14/49 (28%), Positives = 21/49 (42%) Frame = +1 Query: 346 CTQPPMETKMELXKXKHVYVFNK*IKNVFNVCNEFEDINFLCLQPLECK 492 C PP E E HV + + +KN++ N +N C + CK Sbjct: 317 CPHPPCEH--EKKGKSHVQIQDIKLKNIYGTSNNIVAVNLQCSKSFPCK 363 >At1g43090.1 68414.m04964 glycoside hydrolase family 28 protein / polygalacturonase (pectinase) family protein similar to SP|P35339 Exopolygalacturonase precursor (EC 3.2.1.67) (Pectinase) (Galacturan 1,4-alpha-galacturonidase) {Zea mays}; contains Pfam profile PF00295: Glycosyl hydrolases family 28 (polygalacturonases) Length = 444 Score = 29.1 bits (62), Expect = 1.8 Identities = 14/49 (28%), Positives = 21/49 (42%) Frame = +1 Query: 346 CTQPPMETKMELXKXKHVYVFNK*IKNVFNVCNEFEDINFLCLQPLECK 492 C PP E E HV + + +KN++ N +N C + CK Sbjct: 317 CPHPPCEH--EKKGKSHVQIQDIKLKNIYGTSNNIVAVNLQCSKSFPCK 363 >At1g43080.1 68414.m04963 glycoside hydrolase family 28 protein / polygalacturonase (pectinase) family protein similar to SP|P35339 Exopolygalacturonase precursor (EC 3.2.1.67) (Pectinase) (Galacturan 1,4-alpha-galacturonidase) {Zea mays}; contains Pfam profile PF00295: Glycosyl hydrolases family 28 (polygalacturonases) Length = 404 Score = 29.1 bits (62), Expect = 1.8 Identities = 14/49 (28%), Positives = 21/49 (42%) Frame = +1 Query: 346 CTQPPMETKMELXKXKHVYVFNK*IKNVFNVCNEFEDINFLCLQPLECK 492 C PP E E HV + + +KN++ N +N C + CK Sbjct: 317 CPHPPCEH--EKKGESHVQIQDIKLKNIYGTSNNIVAVNLQCSKSFPCK 363 >At1g07700.3 68414.m00829 thioredoxin family protein low similarity to thioredoxin [Gallus gallus] GI:212766; contains Pfam profile: PF00085 Thioredoxin Length = 217 Score = 29.1 bits (62), Expect = 1.8 Identities = 15/35 (42%), Positives = 21/35 (60%), Gaps = 2/35 (5%) Frame = +3 Query: 27 KDSDDLKTRLAEAGD--KLVVIDFMATWCGPCKMI 125 K D+L + L ++ + LVV+DF T CG CK I Sbjct: 104 KTDDELLSVLEKSKETNSLVVVDFYRTACGSCKYI 138 >At1g07700.2 68414.m00827 thioredoxin family protein low similarity to thioredoxin [Gallus gallus] GI:212766; contains Pfam profile: PF00085 Thioredoxin Length = 171 Score = 29.1 bits (62), Expect = 1.8 Identities = 15/35 (42%), Positives = 21/35 (60%), Gaps = 2/35 (5%) Frame = +3 Query: 27 KDSDDLKTRLAEAGD--KLVVIDFMATWCGPCKMI 125 K D+L + L ++ + LVV+DF T CG CK I Sbjct: 91 KTDDELLSVLEKSKETNSLVVVDFYRTACGSCKYI 125 >At1g07700.1 68414.m00828 thioredoxin family protein low similarity to thioredoxin [Gallus gallus] GI:212766; contains Pfam profile: PF00085 Thioredoxin Length = 204 Score = 29.1 bits (62), Expect = 1.8 Identities = 15/35 (42%), Positives = 21/35 (60%), Gaps = 2/35 (5%) Frame = +3 Query: 27 KDSDDLKTRLAEAGD--KLVVIDFMATWCGPCKMI 125 K D+L + L ++ + LVV+DF T CG CK I Sbjct: 91 KTDDELLSVLEKSKETNSLVVVDFYRTACGSCKYI 125 >At4g31240.2 68417.m04435 expressed protein Length = 392 Score = 27.9 bits (59), Expect = 4.1 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +3 Query: 72 KLVVIDFMATWCGPCKMIGPKL 137 K + + F A WC PCK P+L Sbjct: 44 KTICLFFSAIWCRPCKDFTPEL 65 >At4g31240.1 68417.m04434 expressed protein Length = 392 Score = 27.9 bits (59), Expect = 4.1 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +3 Query: 72 KLVVIDFMATWCGPCKMIGPKL 137 K + + F A WC PCK P+L Sbjct: 44 KTICLFFSAIWCRPCKDFTPEL 65 >At5g61340.1 68418.m07697 expressed protein Length = 326 Score = 27.5 bits (58), Expect = 5.4 Identities = 12/25 (48%), Positives = 17/25 (68%), Gaps = 1/25 (4%) Frame = -3 Query: 464 KLISSN-SLQTLKTFFIHLLKTYTC 393 KL+S+N S + F++ LLKTY C Sbjct: 108 KLLSNNHSADSSSVFYLRLLKTYVC 132 >At5g51290.1 68418.m06358 ceramide kinase-related contains weak similarity to ceramide kinases (GI:21624342) [Mus musculus] Length = 608 Score = 27.5 bits (58), Expect = 5.4 Identities = 15/25 (60%), Positives = 16/25 (64%), Gaps = 1/25 (4%) Frame = -3 Query: 215 AGDVLALI-NVHLHNYDGI*HFGGD 144 A DV+A I N LH YDGI GGD Sbjct: 207 AFDVMASIQNKELHTYDGIIAVGGD 231 >At4g13760.1 68417.m02135 glycoside hydrolase family 28 protein / polygalacturonase (pectinase) family protein similar to SP|P35339 Exopolygalacturonase precursor (EC 3.2.1.67) (Pectinase) (Galacturan 1,4-alpha-galacturonidase) {Zea mays}; contains PF00295: Glycosyl hydrolases family 28 (polygalacturonases) Length = 375 Score = 27.5 bits (58), Expect = 5.4 Identities = 13/49 (26%), Positives = 21/49 (42%) Frame = +1 Query: 346 CTQPPMETKMELXKXKHVYVFNK*IKNVFNVCNEFEDINFLCLQPLECK 492 C PP E + + HV + N +KN++ +N C + CK Sbjct: 288 CPHPPCEHEQK--GESHVQIQNLKLKNIYGTSKNKVAVNLQCSKRFPCK 334 >At4g02330.1 68417.m00317 pectinesterase family protein contains Pfam profile: PF01095 pectinesterase Length = 573 Score = 27.5 bits (58), Expect = 5.4 Identities = 12/29 (41%), Positives = 20/29 (68%) Frame = -2 Query: 354 LRTTLVSIYLCLRIVVLSLSTLAPENSSS 268 L+ LV+++L L+ + ++ TL P NSSS Sbjct: 4 LKLFLVTLFLSLQTLFIASQTLLPSNSSS 32 >At3g53220.1 68416.m05864 thioredoxin family protein low similarity to SP|P29451 Thioredoxin [Rhesus macaque] {Macaca mulatta}; contains Pfam profile: PF00085 Thioredoxin Length = 126 Score = 27.1 bits (57), Expect = 7.1 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = +3 Query: 36 DDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIA 149 DD+K+ + A VI++ A+WCG C I P +++ Sbjct: 37 DDIKSSKSPA-----VINYGASWCGVCSQILPAFRKLS 69 >At2g15460.1 68415.m01768 glycoside hydrolase family 28 protein / polygalacturonase (pectinase) family protein similar to SP|P35339 Exopolygalacturonase precursor (EC 3.2.1.67) (Pectinase) (Galacturan 1,4-alpha-galacturonidase) {Zea mays}; contains Pfam profile PF00295: Glycosyl hydrolases family 28 (polygalacturonases) Length = 402 Score = 27.1 bits (57), Expect = 7.1 Identities = 14/49 (28%), Positives = 20/49 (40%) Frame = +1 Query: 346 CTQPPMETKMELXKXKHVYVFNK*IKNVFNVCNEFEDINFLCLQPLECK 492 C PP E E HV + N +KN++ +N C + CK Sbjct: 317 CPHPPCEH--ERKGESHVQIQNLKLKNIYGTSKNKVAVNLQCSKIFPCK 363 >At2g15450.1 68415.m01767 glycoside hydrolase family 28 protein / polygalacturonase (pectinase) family protein similar to SP|P35339 Exopolygalacturonase precursor (EC 3.2.1.67) (Pectinase) (Galacturan 1,4-alpha-galacturonidase) {Zea mays}; contains Pfam profile PF00295: Glycosyl hydrolases family 28 (polygalacturonases) Length = 404 Score = 27.1 bits (57), Expect = 7.1 Identities = 14/49 (28%), Positives = 20/49 (40%) Frame = +1 Query: 346 CTQPPMETKMELXKXKHVYVFNK*IKNVFNVCNEFEDINFLCLQPLECK 492 C PP E E HV + N +KN++ +N C + CK Sbjct: 317 CPHPPCEH--ERKGESHVQIQNLKLKNIYGTSKNKVAVNLQCSKIFPCK 363 >At4g12050.1 68417.m01917 DNA-binding protein-related contains Pfam domain PF03479: Domain of unknown function (DUF296), found in AT-hook motifs Pfam:PF02178 Length = 339 Score = 26.6 bits (56), Expect = 9.4 Identities = 20/49 (40%), Positives = 27/49 (55%), Gaps = 7/49 (14%) Frame = +3 Query: 3 KPKMSIHI-KDSDD-LKTRLAEAGDKLVVIDFMATWC-----GPCKMIG 128 KPK I I +DS + L+T + E GD ++D MAT+ G C M G Sbjct: 130 KPKAPIIITRDSANALRTHVMEIGDGCDIVDCMATFARRRQRGVCVMSG 178 >At2g41680.1 68415.m05149 thioredoxin reductase, putative / NADPH-dependent thioredoxin reductase, putative The last 2 exons encode thioredoxin. There is an EST match to exons 5-7, and the distance between exon 7 and exon 8 is only 90bp. It is unlikely this is two separate genes, but more likely a hybrid protein. Length = 529 Score = 26.6 bits (56), Expect = 9.4 Identities = 8/35 (22%), Positives = 21/35 (60%) Frame = +3 Query: 51 RLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAE 155 +L +++++ + + CGPC+ + P L+++ E Sbjct: 436 KLYHESPRVILVLYTSPTCGPCRTLKPILNKVVDE 470 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,758,403 Number of Sequences: 28952 Number of extensions: 162147 Number of successful extensions: 499 Number of sequences better than 10.0: 63 Number of HSP's better than 10.0 without gapping: 477 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 491 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 888318720 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -