Bombyx BLAST Result against human

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= e96h0905
         (656 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

M76673-1|AAA58482.1|  353|Homo sapiens FMLP-related receptor I p...    30   6.3  

>M76673-1|AAA58482.1|  353|Homo sapiens FMLP-related receptor I
           protein.
          Length = 353

 Score = 30.3 bits (65), Expect = 6.3
 Identities = 19/68 (27%), Positives = 30/68 (44%), Gaps = 2/68 (2%)
 Frame = +1

Query: 343 FTILMPSIVIIVGFAAHKVSSN--VNSPYWRWAFCLLVAPSTGCWVQVEYLLFLAFIYYS 516
           FT+ M  I +  G  A K+  N  + S      F  +VA    CW   E +  L  ++  
Sbjct: 210 FTVPMSIITVCYGIIAAKIHRNHMIKSSRPLRVFAAVVASFFICWFPYELIGILMAVWLK 269

Query: 517 QLLINT*Y 540
           ++L+N  Y
Sbjct: 270 EMLLNGKY 277


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 97,982,748
Number of Sequences: 237096
Number of extensions: 2098823
Number of successful extensions: 3261
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 3200
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3257
length of database: 76,859,062
effective HSP length: 87
effective length of database: 56,231,710
effective search space used: 7366354010
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)