BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0905 (656 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 25 0.64 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 22 4.5 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 22 4.5 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 25.0 bits (52), Expect = 0.64 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = +1 Query: 334 FRQFTILMPSIVIIVGFAAHKVSSNVNSPYWRWA 435 FR+FT S V +G +V S PYW W+ Sbjct: 812 FRKFT--SASDVWSMGIVCWEVMSYGERPYWNWS 843 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 22.2 bits (45), Expect = 4.5 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +3 Query: 600 LVTMCPKFFFN 632 L MCP FFFN Sbjct: 162 LYEMCPYFFFN 172 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 22.2 bits (45), Expect = 4.5 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +3 Query: 600 LVTMCPKFFFN 632 L MCP FFFN Sbjct: 162 LYEMCPYFFFN 172 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 198,677 Number of Sequences: 438 Number of extensions: 5031 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 19734030 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -