SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= e96h0905
         (656 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY921579-1|AAX14899.1|  996|Apis mellifera ephrin receptor protein.    25   0.64 
EF625897-1|ABR45904.1|  684|Apis mellifera hexamerin protein.          22   4.5  
EF591128-1|ABQ59246.1|  684|Apis mellifera hexamerin 70a protein.      22   4.5  

>AY921579-1|AAX14899.1|  996|Apis mellifera ephrin receptor protein.
          Length = 996

 Score = 25.0 bits (52), Expect = 0.64
 Identities = 13/34 (38%), Positives = 17/34 (50%)
 Frame = +1

Query: 334 FRQFTILMPSIVIIVGFAAHKVSSNVNSPYWRWA 435
           FR+FT    S V  +G    +V S    PYW W+
Sbjct: 812 FRKFT--SASDVWSMGIVCWEVMSYGERPYWNWS 843


>EF625897-1|ABR45904.1|  684|Apis mellifera hexamerin protein.
          Length = 684

 Score = 22.2 bits (45), Expect = 4.5
 Identities = 8/11 (72%), Positives = 8/11 (72%)
 Frame = +3

Query: 600 LVTMCPKFFFN 632
           L  MCP FFFN
Sbjct: 162 LYEMCPYFFFN 172


>EF591128-1|ABQ59246.1|  684|Apis mellifera hexamerin 70a protein.
          Length = 684

 Score = 22.2 bits (45), Expect = 4.5
 Identities = 8/11 (72%), Positives = 8/11 (72%)
 Frame = +3

Query: 600 LVTMCPKFFFN 632
           L  MCP FFFN
Sbjct: 162 LYEMCPYFFFN 172


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 198,677
Number of Sequences: 438
Number of extensions: 5031
Number of successful extensions: 6
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 19734030
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -