BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0905 (656 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g25080.1 68416.m03133 hypothetical protein contains Pfam prof... 28 6.3 At3g12060.1 68416.m01500 expressed protein similar to hypothetic... 27 8.3 >At3g25080.1 68416.m03133 hypothetical protein contains Pfam profile PF04776: Protein of unknown function (DUF626) Length = 237 Score = 27.9 bits (59), Expect = 6.3 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = -3 Query: 393 VRCEPYNYHNTWHQDCELPECIPTTP 316 +R EP N + + C LPEC P P Sbjct: 101 IRGEPSNVYTGLNIGCRLPECPPENP 126 >At3g12060.1 68416.m01500 expressed protein similar to hypothetical protein GB:CAB82953 GI:7340710 from [Arabidopsis thaliana] Length = 556 Score = 27.5 bits (58), Expect = 8.3 Identities = 15/43 (34%), Positives = 23/43 (53%) Frame = -2 Query: 328 SNNSPSSIS*QFTKRALTYREFTSAIPRNVTLHNYRSNLLLDT 200 SN+SPSS+ FT E +A+ +N+T + +N DT Sbjct: 83 SNSSPSSLDSNFTTLRTPAPENLTAVTKNLTFESPVANGTTDT 125 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,261,669 Number of Sequences: 28952 Number of extensions: 299196 Number of successful extensions: 489 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 481 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 489 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1373722560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -