BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0898 (543 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC110.04c |pss1|ssp1, SPAP14E8.01c|heat shock protein Pss1|Sch... 29 0.34 SPBP23A10.09 |||GINS complex subunit Psf1 |Schizosaccharomyces p... 28 0.77 SPAC10F6.16 |mug134||endosulphine family protein|Schizosaccharom... 28 1.0 SPCC132.01c ||SPCC1322.17c|DUF814 family protein|Schizosaccharom... 27 1.8 SPAC26A3.01 |sxa1|SPAC2E1P5.06|aspartic protease Sxa1 |Schizosac... 26 4.1 SPBC25D12.02c |dnt1||nucleolar protein Dnt1|Schizosaccharomyces ... 25 5.5 SPBC21C3.02c |sds3||Sds3-like family protein|Schizosaccharomyces... 25 5.5 SPBC2D10.06 |rep1|rec16|MBF transcription factor complex subunit... 25 9.5 >SPAC110.04c |pss1|ssp1, SPAP14E8.01c|heat shock protein Pss1|Schizosaccharomyces pombe|chr 1|||Manual Length = 720 Score = 29.5 bits (63), Expect = 0.34 Identities = 15/35 (42%), Positives = 19/35 (54%) Frame = +1 Query: 136 GERSPTLSETATTARASSVNENGGTLNKLHNSHYD 240 GERS L E A +A AS+ G+L +L YD Sbjct: 46 GERSRFLGEAAKSAEASNFRNTVGSLKRLAGRTYD 80 >SPBP23A10.09 |||GINS complex subunit Psf1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 202 Score = 28.3 bits (60), Expect = 0.77 Identities = 22/68 (32%), Positives = 30/68 (44%), Gaps = 3/68 (4%) Frame = -2 Query: 350 YCWHGAMSRERCSTLASSASSVQCLCVARYGRLF-AIGS*WLLWSL--FRVPPFSLTLEA 180 YCW G E C L +S S+ + + RY L A W L VPP +L ++ Sbjct: 102 YCWSGGKRMESC--LDTSLSTYERDYLTRYSELLAAYKGAWSELDLTGSLVPPKNLFIDV 159 Query: 179 RAVVAVSD 156 R + V D Sbjct: 160 RVLKDVGD 167 >SPAC10F6.16 |mug134||endosulphine family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 139 Score = 27.9 bits (59), Expect = 1.0 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +2 Query: 230 ATTILSRTSVHSAQHTDIEPKMPNSQALNNALGTLPR 340 +TTI++ +S +S Q D+ P Q L G LP+ Sbjct: 10 STTIIAMSSSNSEQKVDVAKLSPEEQKLFRLYGRLPQ 46 >SPCC132.01c ||SPCC1322.17c|DUF814 family protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 1021 Score = 27.1 bits (57), Expect = 1.8 Identities = 17/69 (24%), Positives = 34/69 (49%), Gaps = 6/69 (8%) Frame = +2 Query: 128 KIMVREVQRYRKQRRQLEPRASMKTGVL*TNSTTATTILS------RTSVHSAQHTDIEP 289 K+ +E + R+ RRQ S+K + ++T TIL+ H+A+ +I Sbjct: 782 KVSAKERREARRARRQTALEESLKAPISIEDATDPQTILAILKQKKAKKKHAAREMEISS 841 Query: 290 KMPNSQALN 316 ++P++ + N Sbjct: 842 QIPSNDSSN 850 >SPAC26A3.01 |sxa1|SPAC2E1P5.06|aspartic protease Sxa1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 533 Score = 25.8 bits (54), Expect = 4.1 Identities = 8/31 (25%), Positives = 18/31 (58%) Frame = -3 Query: 166 LFPITLDFSHHYLWINIERLCILNA*FVWTE 74 ++ +TLD Y W+ + + L+A +W++ Sbjct: 88 VYSLTLDTGSPYTWVTAKNITALSASEIWSD 118 >SPBC25D12.02c |dnt1||nucleolar protein Dnt1|Schizosaccharomyces pombe|chr 2|||Manual Length = 599 Score = 25.4 bits (53), Expect = 5.5 Identities = 12/24 (50%), Positives = 18/24 (75%) Frame = +1 Query: 151 TLSETATTARASSVNENGGTLNKL 222 TLSE++TT+ +SS +EN T + L Sbjct: 363 TLSESSTTSISSSPSENSDTSDDL 386 >SPBC21C3.02c |sds3||Sds3-like family protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 491 Score = 25.4 bits (53), Expect = 5.5 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +1 Query: 145 SPTLSETATTARASSVNENGGTLNKLHNS 231 SP+L E+ + + N+N G + HNS Sbjct: 171 SPSLKESDFESEEKATNDNNGLIETNHNS 199 >SPBC2D10.06 |rep1|rec16|MBF transcription factor complex subunit Rep1|Schizosaccharomyces pombe|chr 2|||Manual Length = 472 Score = 24.6 bits (51), Expect = 9.5 Identities = 12/45 (26%), Positives = 22/45 (48%) Frame = +2 Query: 47 VDDADLQLDFSPNKSRVQYTQTFNIYPKIMVREVQRYRKQRRQLE 181 +DDADL SP SR ++ + P + + ++Q + +E Sbjct: 402 IDDADLVFHSSPLLSRSRFICCYCTKPFLSISKLQEHESSCSHVE 446 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,290,370 Number of Sequences: 5004 Number of extensions: 44528 Number of successful extensions: 127 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 123 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 127 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 223909422 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -