BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0897 (514 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 24 0.69 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 24.2 bits (50), Expect = 0.69 Identities = 8/30 (26%), Positives = 14/30 (46%) Frame = +3 Query: 102 VCLFIIWYIFFYKCLTFKLLRFEYTVLLCL 191 VC++ +Y+ C F + LLC+ Sbjct: 256 VCIYYFYYMHLLFCCAFIIFTMHLLFLLCI 285 Score = 23.8 bits (49), Expect = 0.91 Identities = 10/31 (32%), Positives = 14/31 (45%) Frame = +3 Query: 105 CLFIIWYIFFYKCLTFKLLRFEYTVLLCLNH 197 C FII+ + C F LLCL++ Sbjct: 171 CAFIIFTMHLLFCCAFIFFNMHLLFLLCLDY 201 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 104,551 Number of Sequences: 336 Number of extensions: 2027 Number of successful extensions: 2 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12258909 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -