BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0888 (622 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory recept... 21 6.3 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 21 8.3 >AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory receptor candidate 15 protein. Length = 455 Score = 21.4 bits (43), Expect = 6.3 Identities = 7/28 (25%), Positives = 17/28 (60%) Frame = +2 Query: 254 HMYIWRMLLQKLRWKRLQNSVLQVQIAD 337 H+++ M L++ +W L +L+++ D Sbjct: 82 HVFVTMMTLKRHKWSTLFEILLKLESKD 109 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 21.0 bits (42), Expect = 8.3 Identities = 12/42 (28%), Positives = 19/42 (45%) Frame = -3 Query: 587 CFSKLHNND*ISDFKLYDKIKISLMITRKHYINRKHSLFIPN 462 C S+L N I L +K + + + + +I LF PN Sbjct: 469 CVSQLKNALSIDKGILREKPDVKIFLPFRFHIYTPEDLFAPN 510 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 112,926 Number of Sequences: 336 Number of extensions: 2108 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15875032 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -