BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0883 (438 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF393494-1|AAL60419.1| 144|Apis mellifera odorant binding prote... 23 1.5 AF166496-1|AAD51944.1| 144|Apis mellifera pheromone-binding pro... 23 1.5 DQ435324-1|ABD92639.1| 152|Apis mellifera OBP3 protein. 21 4.5 AB208108-1|BAE72140.1| 92|Apis mellifera Broad complex zinc fi... 21 4.5 >AF393494-1|AAL60419.1| 144|Apis mellifera odorant binding protein ASP1 protein. Length = 144 Score = 23.0 bits (47), Expect = 1.5 Identities = 10/40 (25%), Positives = 17/40 (42%) Frame = -2 Query: 374 LILGLPPSLTTSKGQCFMSACTVASXELTSDETFGIEXCV 255 ++LGL P + Q M C S ++ + + CV Sbjct: 94 IMLGLLPDQLQERAQSVMGKCLPTSGSDNCNKIYNLAKCV 133 >AF166496-1|AAD51944.1| 144|Apis mellifera pheromone-binding protein ASP1 protein. Length = 144 Score = 23.0 bits (47), Expect = 1.5 Identities = 10/40 (25%), Positives = 17/40 (42%) Frame = -2 Query: 374 LILGLPPSLTTSKGQCFMSACTVASXELTSDETFGIEXCV 255 ++LGL P + Q M C S ++ + + CV Sbjct: 94 IMLGLLPDQLQERAQSVMGKCLPTSGSDNCNKIYNLAKCV 133 >DQ435324-1|ABD92639.1| 152|Apis mellifera OBP3 protein. Length = 152 Score = 21.4 bits (43), Expect = 4.5 Identities = 11/41 (26%), Positives = 19/41 (46%) Frame = +3 Query: 183 YVAFTDTERLIGDAAXXQVAMIPXNTXFDAKRLIGRKFARC 305 Y+ TD + + D+ + N + K L +KF+RC Sbjct: 80 YLNDTDMDMDLKDSIRKIIRQCVDNAKNEDKCLTAQKFSRC 120 >AB208108-1|BAE72140.1| 92|Apis mellifera Broad complex zinc finger domain-Z3 isoform protein. Length = 92 Score = 21.4 bits (43), Expect = 4.5 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -1 Query: 66 PFCIFNQSCYLFLKQ 22 P+C N SCY LK+ Sbjct: 9 PYCRRNFSCYYSLKR 23 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 121,965 Number of Sequences: 438 Number of extensions: 2710 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 11327868 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -