BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0882 (657 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Y08163-1|CAA69355.1| 192|Anopheles gambiae hypothetical protein... 27 0.69 AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein ... 23 6.4 >Y08163-1|CAA69355.1| 192|Anopheles gambiae hypothetical protein protein. Length = 192 Score = 26.6 bits (56), Expect = 0.69 Identities = 16/45 (35%), Positives = 22/45 (48%) Frame = +2 Query: 278 KNLKNASRNEDLSPLHWRVLASNTGSIRNNWTVGSNIGQKNTHSL 412 K L ++ L + AS+TGS N W +NIG NT+ L Sbjct: 97 KGLATIESEKEQKYLESLLKASSTGS--NYWIGATNIGASNTNKL 139 >AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein protein. Length = 699 Score = 23.4 bits (48), Expect = 6.4 Identities = 16/58 (27%), Positives = 28/58 (48%), Gaps = 4/58 (6%) Frame = -1 Query: 504 GTFGSNPHEVNIQTLDISLEMRILVKELLPFSEWV---FFCP-IFEPTVQLFRIEPVF 343 G+ G N + ++ L + ++R+L E LP+ V P +F VQ + P+F Sbjct: 241 GSGGFNATDPTMERLSLEEKLRVLFYEFLPYLAIVCMNLVVPQLFNYLVQYEKYSPLF 298 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 720,356 Number of Sequences: 2352 Number of extensions: 15550 Number of successful extensions: 43 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 42 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 43 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 65232180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -