BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0882 (657 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex det... 23 2.6 DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex det... 23 2.6 DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex det... 23 2.6 DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex det... 23 2.6 DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex det... 23 2.6 DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex det... 23 2.6 DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex det... 23 2.6 DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex det... 23 2.6 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 23 2.6 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 23 2.6 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 22 5.9 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 22 5.9 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 22 5.9 >DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 2.6 Identities = 8/25 (32%), Positives = 13/25 (52%) Frame = +2 Query: 335 LASNTGSIRNNWTVGSNIGQKNTHS 409 + SN S+ NN+ +N N H+ Sbjct: 81 IISNNNSLSNNYNYNNNYNNYNKHN 105 >DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 2.6 Identities = 8/25 (32%), Positives = 13/25 (52%) Frame = +2 Query: 335 LASNTGSIRNNWTVGSNIGQKNTHS 409 + SN S+ NN+ +N N H+ Sbjct: 81 IISNNNSLSNNYNYNNNYNNYNKHN 105 >DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 2.6 Identities = 8/25 (32%), Positives = 13/25 (52%) Frame = +2 Query: 335 LASNTGSIRNNWTVGSNIGQKNTHS 409 + SN S+ NN+ +N N H+ Sbjct: 81 IISNNNSLSNNYNYNNNYNNYNKHN 105 >DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 2.6 Identities = 8/25 (32%), Positives = 13/25 (52%) Frame = +2 Query: 335 LASNTGSIRNNWTVGSNIGQKNTHS 409 + SN S+ NN+ +N N H+ Sbjct: 81 IISNNNSLSNNYNYNNNYNNYNKHN 105 >DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 2.6 Identities = 8/25 (32%), Positives = 13/25 (52%) Frame = +2 Query: 335 LASNTGSIRNNWTVGSNIGQKNTHS 409 + SN S+ NN+ +N N H+ Sbjct: 81 IISNNNSLSNNYNYNNNYNNYNKHN 105 >DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 2.6 Identities = 8/25 (32%), Positives = 13/25 (52%) Frame = +2 Query: 335 LASNTGSIRNNWTVGSNIGQKNTHS 409 + SN S+ NN+ +N N H+ Sbjct: 81 IISNNNSLSNNYNYNNNYNNYNKHN 105 >DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 2.6 Identities = 8/25 (32%), Positives = 13/25 (52%) Frame = +2 Query: 335 LASNTGSIRNNWTVGSNIGQKNTHS 409 + SN S+ NN+ +N N H+ Sbjct: 81 IISNNNSLSNNYNYNNNYNNYNKHN 105 >DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 2.6 Identities = 8/25 (32%), Positives = 13/25 (52%) Frame = +2 Query: 335 LASNTGSIRNNWTVGSNIGQKNTHS 409 + SN S+ NN+ +N N H+ Sbjct: 81 IISNNNSLSNNYNYNNNYNNYNKHN 105 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 23.0 bits (47), Expect = 2.6 Identities = 8/25 (32%), Positives = 13/25 (52%) Frame = +2 Query: 335 LASNTGSIRNNWTVGSNIGQKNTHS 409 + SN S+ NN+ +N N H+ Sbjct: 314 IISNNNSLSNNYNYNNNYNNYNKHN 338 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 23.0 bits (47), Expect = 2.6 Identities = 8/25 (32%), Positives = 13/25 (52%) Frame = +2 Query: 335 LASNTGSIRNNWTVGSNIGQKNTHS 409 + SN S+ NN+ +N N H+ Sbjct: 314 IISNNNSLSNNYNYNNNYNNYNKHN 338 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 21.8 bits (44), Expect = 5.9 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +1 Query: 409 AERQKFLNQYPHFKTNIQ 462 A ++ LN YP F+ N+Q Sbjct: 637 ASMKENLNVYPEFQENVQ 654 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 21.8 bits (44), Expect = 5.9 Identities = 6/24 (25%), Positives = 14/24 (58%) Frame = -1 Query: 390 PIFEPTVQLFRIEPVFEANTLQWR 319 P+F + L+ ++P ++A W+ Sbjct: 400 PVFHQEMALYYLKPSYDAQEPAWK 423 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.8 bits (44), Expect = 5.9 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +2 Query: 164 PPPMPKLDLEEWWGPPELKQKQDTSIKPFETL 259 PP + ++D +E G E K+ + +KP +L Sbjct: 690 PPQVDEVDDKELSGAEEEKEVEKALLKPLLSL 721 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 198,871 Number of Sequences: 438 Number of extensions: 4588 Number of successful extensions: 15 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 19734030 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -