BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0875 (645 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g02260.1 68416.m00207 auxin transport protein (BIG) nearly id... 29 2.6 At3g47080.1 68416.m05112 expressed protein 28 6.1 >At3g02260.1 68416.m00207 auxin transport protein (BIG) nearly identical to auxin transport protein; BIG [Arabidopsis thaliana] GI:21779966; contains Pfam profiles PF02207: Putative zinc finger in N-recognin, PF00569: Zinc finger ZZ type Length = 5098 Score = 29.1 bits (62), Expect = 2.6 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -2 Query: 617 VLQWAASHKRLEARTXCRGLWVHAFRNFR 531 +L+W +S R EA++ GLW H +F+ Sbjct: 3208 LLEWNSSSVRTEAKSVIYGLWHHGRHSFK 3236 >At3g47080.1 68416.m05112 expressed protein Length = 515 Score = 27.9 bits (59), Expect = 6.1 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = -1 Query: 348 CSARKVFKQITIIIEEILNFEQQTALIVSEQTMAAAHDS 232 CS + F + +IEE+ +F QT + V +Q H S Sbjct: 217 CSINRAFSSMVFMIEELHSFALQTRVGVLKQVKKEMHAS 255 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,969,770 Number of Sequences: 28952 Number of extensions: 253163 Number of successful extensions: 684 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 662 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 684 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1334473344 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -