BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0874 (628 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X87410-1|CAA60857.1| 498|Anopheles gambiae maltase-like protein... 23 6.0 DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren... 23 6.0 AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcript... 23 7.9 >X87410-1|CAA60857.1| 498|Anopheles gambiae maltase-like protein Agm1 protein. Length = 498 Score = 23.4 bits (48), Expect = 6.0 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +2 Query: 509 STVPYLAIVMSI*SFLKCQHWVS*QNCYDI 598 STV L +++ + S L +HW N Y I Sbjct: 3 STVILLGVLLIVPSLLADEHWWQHANFYQI 32 >DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methoprene-tolerant protein protein. Length = 1115 Score = 23.4 bits (48), Expect = 6.0 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -3 Query: 149 SVDLGESCVESGSIADIERSAAVSTLGSPPPSQP 48 S S V +G + RSA +GSPPP P Sbjct: 756 SSSTASSSVSTG-MPSPSRSAFADGIGSPPPPPP 788 >AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcriptase protein. Length = 988 Score = 23.0 bits (47), Expect = 7.9 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = -3 Query: 431 VPNTISREITDSSGPGAVSSVSN 363 VPN S +TD++G AV SV + Sbjct: 39 VPNNNSNWVTDTTGRVAVVSVGD 61 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 619,030 Number of Sequences: 2352 Number of extensions: 12015 Number of successful extensions: 14 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 61050630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -